DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mAChR-C and Taar4

DIOPT Version :9

Sequence 1:NP_572358.1 Gene:mAChR-C / 31626 FlyBaseID:FBgn0029909 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001008499.1 Gene:Taar4 / 209513 MGIID:2685072 Length:347 Species:Mus musculus


Alignment Length:318 Identity:81/318 - (25%)
Similarity:134/318 - (42%) Gaps:76/318 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 LFVLILG-------GNILTIVAVRTCRHLRSVISNLFILSLAVSDF---CVGLALPYHLV----- 109
            ::::::|       ||:..|:::...:.|.|. :|..|||:|.:||   ||  .:|:.::     
Mouse    36 MYLIMIGAIVMTMLGNMAVIISIAHFKQLHSP-TNFLILSMATTDFLLSCV--VMPFSMIRSIES 97

  Fly   110 -FYMGSDIGAMRGPCLLRFFLLICACCVSMLTLIS------IAVDRYIAVVYALHYRRYMTRRVA 167
             :|.|.            .|..:.:||..||...|      |:|||:.||...|||...:|.||.
Mouse    98 CWYFGD------------LFCKVHSCCDIMLCTTSIFHLCFISVDRHYAVCDPLHYVTQITTRVV 150

  Fly   168 YSIIIFNWCLGALVALLPVFWNRWPDAQACEFDEVLAPGYIAGVITPGFVI-----IW------I 221
            ...::.:|.:....|...||         .|.:.:.|..::|.:...|..:     :|      |
Mouse   151 GVFLLISWSVPIFFAFGLVF---------SELNLIGAEDFVAAIDCTGLCVLIFNKLWGVLASFI 206

  Fly   222 CMFL-------VYWRIMREASKQAL------RLRQSVVYNTDEATTMRNLLLHPDWKSVQIVVFI 273
            ..||       :|..|...|.|.|.      |.:|::..:..:||:.:      :.|:.:.:..:
Mouse   207 AFFLPGTVMVGIYIHIFTVAQKHARQIGTGPRTKQALSESKMKATSKK------ESKATKTLSIV 265

  Fly   274 MGCFTLCWLPYFCVAIAQLFSICQSSSMIYKTTFSLAIANSALNPIIYSWKNSGFRRA 331
            ||.|.|||||:|.:.|...|....:...:|.....|...||..|||||......||:|
Mouse   266 MGVFVLCWLPFFVLTITDPFIDFTTPEDLYNVFLWLGYFNSTFNPIIYGMFYPWFRKA 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mAChR-CNP_572358.1 7tm_4 61..332 CDD:304433 81/317 (26%)
7tm_1 67..321 CDD:278431 75/292 (26%)
Taar4NP_001008499.1 7tm_4 34..>170 CDD:304433 38/148 (26%)
7tm_1 50..313 CDD:278431 75/292 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24249
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.