DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mAChR-C and Taar2

DIOPT Version :9

Sequence 1:NP_572358.1 Gene:mAChR-C / 31626 FlyBaseID:FBgn0029909 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001007267.1 Gene:Taar2 / 209512 MGIID:2685071 Length:339 Species:Mus musculus


Alignment Length:308 Identity:80/308 - (25%)
Similarity:136/308 - (44%) Gaps:42/308 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 SFGAGHLLWLAINAFLFVLILGGNILTIVAVRTCRHLRSVISNLFILSLAVSDFCVGLA-LPYHL 108
            |.|....::..:...:|:.|. ||:..|:::...:.|.:. :||.|||:||:||.:|.. :||.:
Mouse    27 SLGVRAAMYSLMACAIFITIF-GNLAMIISISYFKQLHTP-TNLLILSMAVTDFLLGFTIMPYSM 89

  Fly   109 V------FYMGSDIGAMRGPCLLRFFLLICACCVSMLTLISIAVDRYIAVVYALHYRRYMTRRVA 167
            |      :|.|...      |.:.:...:.....|:..|.|:||||:.|:.:.|||...||..|.
Mouse    90 VRSVENCWYFGLTF------CKIHYSFDLMLSITSIFHLCSVAVDRFYAICHPLHYCTKMTIPVV 148

  Fly   168 YSIIIFNWCLGALVALLPVFWNRWPDA-------QACE------FDEVLAPG-YIAGVITPGFVI 218
            ..:::..|.:....|...||...:.|.       .||.      |:::.... ::||..||..::
Mouse   149 RRLLLVCWSVPGAFAFGVVFSEAYADGIEGYDILVACSSSCPVMFNKLWGTTLFVAGFFTPSSMM 213

  Fly   219 IWICMFLVYWRIMREASKQALRLRQSVVYNTDEATTMRNLLLHPDWKSVQIVVFIMGCFTLCWLP 283
            :.|     |.:|...:.|.|     .|:.|..|   .:|..:..|.|:.:.:..:||.|.|||.|
Mouse   214 VGI-----YGKIFAVSKKHA-----RVIDNLPE---NQNNQMRKDKKAAKTLGIVMGVFLLCWFP 265

  Fly   284 YFCVAIAQLFSICQSSSMIYKTTFSLAIANSALNPIIYSWKNSGFRRA 331
            .|...:...|....:.::::.........||..||:||.:....||||
Mouse   266 CFFTILLDPFLNFSTPAVLFDALTWFGYFNSTCNPLIYGFFYPWFRRA 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mAChR-CNP_572358.1 7tm_4 61..332 CDD:304433 78/292 (27%)
7tm_1 67..321 CDD:278431 70/274 (26%)
Taar2NP_001007267.1 7tm_4 40..321 CDD:304433 78/295 (26%)
7tm_1 48..303 CDD:278431 70/274 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24249
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.