DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mAChR-C and ADRB1

DIOPT Version :9

Sequence 1:NP_572358.1 Gene:mAChR-C / 31626 FlyBaseID:FBgn0029909 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_000675.1 Gene:ADRB1 / 153 HGNCID:285 Length:477 Species:Homo sapiens


Alignment Length:433 Identity:121/433 - (27%)
Similarity:185/433 - (42%) Gaps:104/433 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SSSSPAWD---------YRSSPEALGVVPFLWQHQNATETPTEITLQATSFGAGHLLWLAINAFL 60
            ||::|..|         ..:||.|..:.|       |:|:|..::.|.|: |.|.|:     |.:
Human    17 SSAAPLPDGAATAARLLVPASPPASLLPP-------ASESPEPLSQQWTA-GMGLLM-----ALI 68

  Fly    61 FVLILGGNILTIVAVRTCRHLRSVISNLFILSLAVSDFCVGLALPYHLVFYMGSDI---GAMR-G 121
            .:||:.||:|.|||:.....|:: ::||||:|||.:|..:||     ||...|:.|   |... |
Human    69 VLLIVAGNVLVIVAIAKTPRLQT-LTNLFIMSLASADLVMGL-----LVVPFGATIVVWGRWEYG 127

  Fly   122 PCLLRFFLLICACCV--SMLTLISIAVDRYIAVVYALHYRRYMTRRVAYSIIIFNWCLGALVALL 184
            ......:..:...||  |:.||..||:|||:|:.....|:..:||..|..::...|.:.|||:.|
Human   128 SFFCELWTSVDVLCVTASIETLCVIALDRYLAITSPFRYQSLLTRARARGLVCTVWAISALVSFL 192

  Fly   185 PVFWNRW-----------PDAQACEFDEVLAPGYIAGVITPGFVIIWICMFLVYWRIMREASKQA 238
            |:..:.|           .|.:.|:|....|....:.|::  |.:....|..||.|:.|||.||.
Human   193 PILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASSVVS--FYVPLCIMAFVYLRVFREAQKQV 255

  Fly   239 LRL--------------------------------RQSVVYNTDEATTMR-------NLLLHPDW 264
            .::                                |.:....|......|       .|:...:.
Human   256 KKIDSCERRFLGGPARPPSPSPSPVPAPAPPPGPPRPAAAAATAPLANGRAGKRRPSRLVALREQ 320

  Fly   265 KSVQIVVFIMGCFTLCWLPYFCVAIAQLFSICQSSSMIYKTTFSLAIANSALNPIIYSWKNSGFR 329
            |:::.:..|||.|||||||:|...:.:.|........::.....|..||||.|||||. ::..||
Human   321 KALKTLGIIMGVFTLCWLPFFLANVVKAFHRELVPDRLFVFFNWLGYANSAFNPIIYC-RSPDFR 384

  Fly   330 RAFVQTLCC--RTARQCEDQLPADSKHRMEATSSSQEIKPKAT 370
            :||...|||  |.||            |..||...   :|:|:
Human   385 KAFQGLLCCARRAAR------------RRHATHGD---RPRAS 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mAChR-CNP_572358.1 7tm_4 61..332 CDD:304433 91/326 (28%)
7tm_1 67..321 CDD:278431 85/309 (28%)
ADRB1NP_000675.1 7tm_4 67..>266 CDD:304433 62/206 (30%)
7tm_1 75..377 CDD:278431 85/309 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 269..307 3/37 (8%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 403..477 4/13 (31%)
PDZ-Binding 474..477
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.