DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mAChR-C and Drd1

DIOPT Version :9

Sequence 1:NP_572358.1 Gene:mAChR-C / 31626 FlyBaseID:FBgn0029909 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001278730.1 Gene:Drd1 / 13488 MGIID:99578 Length:446 Species:Mus musculus


Alignment Length:329 Identity:104/329 - (31%)
Similarity:147/329 - (44%) Gaps:58/329 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 FLFVLILG---GNILTIVAVRTCRHLRSVISNLFILSLAVSDFCVG-LALPYHLVFYMGS--DIG 117
            ||.:|||.   ||.|...||...|||||.::|.|::||||||..|. |.:|:..|..:..  ..|
Mouse    28 FLSLLILSTLLGNTLVCAAVIRFRHLRSKVTNFFVISLAVSDLLVAVLVMPWKAVAEIAGFWPFG 92

  Fly   118 AMRGPCLLRFFLLICACCVSMLTLISIAVDRYIAVVYALHYRRYMTRRVAYSIIIFNWCLGALVA 182
            :.   |.:.....|.....|:|.|..|:||||.|:.....|.|.||.:.|:.:|...|.|..|::
Mouse    93 SF---CNIWVAFDIMCSTASILNLCVISVDRYWAISSPFQYERKMTPKAAFILISVAWTLSVLIS 154

  Fly   183 LLPV--FWNR----WP---------DAQACEFDEVLAPGYIAGVITPGFVIIWICMFLVYWRIMR 232
            .:||  .|::    ||         ||:....|..|:..|........|.|....|.:.|..|.|
Mouse   155 FIPVQLSWHKAKPTWPLDGNFTSLEDAEDDNCDTRLSRTYAISSSLISFYIPVAIMIVTYTSIYR 219

  Fly   233 EASKQALR---LRQSVVYNTDEATTMRN--------------LLLHPDWKSVQIVVFIMGCFTLC 280
            .|.||..|   |.::.|:..:..||..|              :....:.|.::.:..|||.|..|
Mouse   220 IAQKQIRRISALERAAVHAKNCQTTTGNGNPVECSQSESSFKMSFKRETKVLKTLSVIMGVFVCC 284

  Fly   281 WLPYF---CVAIAQLFSICQSSS----MIYKTTFSLAI----ANSALNPIIYSWKNSGFRRAFVQ 334
            |||:|   |     :...|.|..    .|...||.:.:    |||:||||||:: |:.|::||..
Mouse   285 WLPFFISNC-----MVPFCGSEETQPFCIDSITFDVFVWFGWANSSLNPIIYAF-NADFQKAFST 343

  Fly   335 TLCC 338
            .|.|
Mouse   344 LLGC 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mAChR-CNP_572358.1 7tm_4 61..332 CDD:304433 98/319 (31%)
7tm_1 67..321 CDD:278431 91/299 (30%)
Drd1NP_001278730.1 7tm_1 39..331 CDD:278431 91/299 (30%)
7tm_4 40..>157 CDD:304433 42/119 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.