DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mAChR-C and TAAR1

DIOPT Version :9

Sequence 1:NP_572358.1 Gene:mAChR-C / 31626 FlyBaseID:FBgn0029909 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_612200.1 Gene:TAAR1 / 134864 HGNCID:17734 Length:339 Species:Homo sapiens


Alignment Length:299 Identity:82/299 - (27%)
Similarity:127/299 - (42%) Gaps:30/299 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 LFVLI----LGGNILTIVAVRTCRHLRSVISNLFILSLAVSDFCVG-LALPYHLV------FYMG 113
            |.|||    |.||::.||::...:.|.:. :|..|.|:|..||.:| |.:||.:|      :|.|
Human    29 LMVLIILTTLVGNLIVIVSISHFKQLHTP-TNWLIHSMATVDFLLGCLVMPYSMVRSAEHCWYFG 92

  Fly   114 SDIGAMRGPCLLRFFLLICACCVSMLTLISIAVDRYIAVVYALHYRRYMTRRVAYSIIIFNWCLG 178
            ...      |.:.....|.....|:..|..|::|||.||...|.|:..|...|...:|..:|.:.
Human    93 EVF------CKIHTSTDIMLSSASIFHLSFISIDRYYAVCDPLRYKAKMNILVICVMIFISWSVP 151

  Fly   179 ALVALLPVFWN-RWPDAQACEFDEVLAPG-------YIAGVIT--PGFVIIWICMFLVYWRIMRE 233
            |:.|...:|.. .:..|:...:..|...|       .|:||:|  ..|.|....|..||:||...
Human   152 AVFAFGMIFLELNFKGAEEIYYKHVHCRGGCSVFFSKISGVLTFMTSFYIPGSIMLCVYYRIYLI 216

  Fly   234 ASKQALRLRQSVVYNTDEATTMRN-LLLHPDWKSVQIVVFIMGCFTLCWLPYFCVAIAQLFSICQ 297
            |.:|| ||.............|:| :....:.|:|:.:..:||.|.:||.|:|...:...|....
Human   217 AKEQA-RLISDANQKLQIGLEMKNGISQSKERKAVKTLGIVMGVFLICWCPFFICTVMDPFLHYI 280

  Fly   298 SSSMIYKTTFSLAIANSALNPIIYSWKNSGFRRAFVQTL 336
            ....:..........||..||::|::....||:|....|
Human   281 IPPTLNDVLIWFGYLNSTFNPMVYAFFYPWFRKALKMML 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mAChR-CNP_572358.1 7tm_4 61..332 CDD:304433 79/292 (27%)
7tm_1 67..321 CDD:278431 72/271 (27%)
TAAR1NP_612200.1 7tm_4 38..319 CDD:304433 77/288 (27%)
7tm_1 40..304 CDD:278431 72/271 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24249
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.