DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mAChR-C and TAAR9

DIOPT Version :9

Sequence 1:NP_572358.1 Gene:mAChR-C / 31626 FlyBaseID:FBgn0029909 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_778227.3 Gene:TAAR9 / 134860 HGNCID:20977 Length:348 Species:Homo sapiens


Alignment Length:347 Identity:79/347 - (22%)
Similarity:139/347 - (40%) Gaps:48/347 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FTSSSSPAWDYRSSPEALGVVPFLWQHQNATETPTEITLQATSFGAGHLLWLAINAFLFVLILGG 67
            |:.:.:....|::..|:....|:       :..|..|......|||             ||...|
Human     5 FSQAEAVELCYKNVNESCIKTPY-------SPGPRSILYAVLGFGA-------------VLAAFG 49

  Fly    68 NILTIVAVRTCRHLRSVISNLFILSLAVSDFCVGL-ALPYHLV------FYMGSDIGAMRGPCLL 125
            |:|.::|:...:.|.:. :|..|.|||.:||.||: .:|:..|      :|.|...      |..
Human    50 NLLVMIAILHFKQLHTP-TNFLIASLACADFLVGVTVMPFSTVRSVESCWYFGDSY------CKF 107

  Fly   126 RFFLLICACCVSMLTLISIAVDRYIAVVYALHYRRYMTRRVAYSIIIFNWCLGALVALLPVFWNR 190
            ........|..|:..|..|:|||||||...|.|....|..|:...|:.:|......: ..:|:. 
Human   108 HTCFDTSFCFASLFHLCCISVDRYIAVTDPLTYPTKFTVSVSGICIVLSWFFSVTYS-FSIFYT- 170

  Fly   191 WPDAQACEFDEVLAPGYIAGVITP--------GFVIIWI---CMFLVYWRIMREASKQALRLRQS 244
            ..:.:..| :.|:|...:.|...|        .|::.:|   .|..:|.:|...|..||.::..:
Human   171 GANEEGIE-ELVVALTCVGGCQAPLNQNWVLLCFLLFFIPNVAMVFIYSKIFLVAKHQARKIEST 234

  Fly   245 VVYNTDEATTMRNLLLHPDWKSVQIVVFIMGCFTLCWLPYFCVAIAQLFSICQSSSMIYKTTFSL 309
            .......:.:.:..:...:.|:.:.:...|..|.:.||||...|:...:....:...:|:.....
Human   235 ASQAQSSSESYKERVAKRERKAAKTLGIAMAAFLVSWLPYLVDAVIDAYMNFITPPYVYEILVWC 299

  Fly   310 AIANSALNPIIYSWKNSGFRRA 331
            ...|||:||:||::....|.:|
Human   300 VYYNSAMNPLIYAFFYQWFGKA 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mAChR-CNP_572358.1 7tm_4 61..332 CDD:304433 70/289 (24%)
7tm_1 67..321 CDD:278431 64/271 (24%)
TAAR9NP_778227.3 7tm_4 43..>271 CDD:304433 56/250 (22%)
7tm_1 49..311 CDD:278431 64/271 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24249
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.