DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mAChR-C and ADORA1

DIOPT Version :9

Sequence 1:NP_572358.1 Gene:mAChR-C / 31626 FlyBaseID:FBgn0029909 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_000665.1 Gene:ADORA1 / 134 HGNCID:262 Length:326 Species:Homo sapiens


Alignment Length:339 Identity:94/339 - (27%)
Similarity:153/339 - (45%) Gaps:52/339 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 SFGAGHLLWLAINAFLFVLILGGNILTIVAVRTCRHLRSVISNLFILSLAVSDFCVG-LALPYHL 108
            |..|....::.|...:.::.:.||:|.|.||:..:.||.. :..||:||||:|..|| |.:|..:
Human     4 SISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDA-TFCFIVSLAVADVAVGALVIPLAI 67

  Fly   109 VFYMGSDIGAMRGPCLLRFFLLICACCV------SMLTLISIAVDRYIAVVYALHYRRYMTRRVA 167
            :..:        ||.......|:.||.|      |:|.|::||||||:.|...|.|:..:|.|.|
Human    68 LINI--------GPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKMVVTPRRA 124

  Fly   168 YSIIIFNWCLGALVALLPVF-WNRWPDAQ--------------ACEFDEVLAPGYIAGVITPGFV 217
            ...|...|.|..:|.|.|:| ||.....:              .|||::|::..|   ::...| 
Human   125 AVAIAGCWILSFVVGLTPMFGWNNLSAVERAWAANGSMGEPVIKCEFEKVISMEY---MVYFNF- 185

  Fly   218 IIWI-----CMFLVYWRIMREASKQALRLRQSVVYNTDEATTMRNLLLHPDWKSVQIVVFIMGCF 277
            .:|:     .|.|:|..:.....|| |..:.|......:....:.|.:.   ||:.:::|:   |
Human   186 FVWVLPPLLLMVLIYLEVFYLIRKQ-LNKKVSASSGDPQKYYGKELKIA---KSLALILFL---F 243

  Fly   278 TLCWLPYFCVAIAQLF-SICQSSSMIYKTTFSLAIANSALNPIIYSWKNSGFRRAFVQT----LC 337
            .|.|||...:....|| ..|...|::......|...|||:|||:|:::...||..|::.    ..
Human   244 ALSWLPLHILNCITLFCPSCHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFLKIWNDHFR 308

  Fly   338 CRTARQCEDQLPAD 351
            |:.|...::.||.:
Human   309 CQPAPPIDEDLPEE 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mAChR-CNP_572358.1 7tm_4 61..332 CDD:304433 86/298 (29%)
7tm_1 67..321 CDD:278431 83/281 (30%)
ADORA1NP_000665.1 7tm_4 18..>137 CDD:304433 43/127 (34%)
7tm_1 26..288 CDD:278431 83/281 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D252862at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.