DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mAChR-C and Taar1

DIOPT Version :9

Sequence 1:NP_572358.1 Gene:mAChR-C / 31626 FlyBaseID:FBgn0029909 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_599155.1 Gene:Taar1 / 113914 RGDID:621621 Length:332 Species:Rattus norvegicus


Alignment Length:322 Identity:81/322 - (25%)
Similarity:131/322 - (40%) Gaps:67/322 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 INAFLFVLI-------LGGNILTIVAVRTCRHLRSVISNLFILSLAVSDFCVG-LALPYHLV--- 109
            :.|.|:.||       |.||::.|:::...:.|.:. :|..:.|:||.||.:| |.:||.:|   
  Rat    21 VRASLYSLISLIILTTLVGNLIVIISISHFKQLHTP-TNWLLHSMAVVDFLLGCLVMPYSMVRTV 84

  Fly   110 ---FYMGSDIGAMRGPCLLRFFLLICACCVSMLTLISIAVDRYIAVVYALHYRRYMTRRVAYSII 171
               :|.|...      |.|.....|.....|:|.|..|::|||.||...|.|:..:.....:.:|
  Rat    85 EHCWYFGELF------CKLHTSTDIMLSSASILHLAFISIDRYYAVCDPLRYKAKINLAAIFVMI 143

  Fly   172 IFNWCLGALVALLPVF------------WNRWPDAQAC-----EFDEVLAPGYIAGVITPGFVII 219
            :.:|.|.|:.|...:|            .|:....:.|     :...|||  ::.....||.|  
  Rat   144 LISWSLPAVFAFGMIFLELNLEGVEEQYHNQVFCLRGCFPFFSKVSGVLA--FMTSFYIPGSV-- 204

  Fly   220 WICMFLVYWRIMREASKQALRLRQSVVYNTDEATTMRNLLL----------HPDWKSVQIVVFIM 274
               |..||:||...|..||..:.::            ||.:          ..:.|:.:.:..::
  Rat   205 ---MLFVYYRIYFIAKGQARSINRA------------NLQVGLEGESRAPQSKETKAAKTLGIMV 254

  Fly   275 GCFTLCWLPYFCVAIAQLFSICQSSSMIYKTTFSLAIANSALNPIIYSWKNSGFRRAFVQTL 336
            |.|.|||.|:|...:...|........:..|.......|||.||::|::....||||....|
  Rat   255 GVFLLCWCPFFFCMVLDPFLGYVIPPTLNDTLNWFGYLNSAFNPMVYAFFYPWFRRALKMVL 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mAChR-CNP_572358.1 7tm_4 61..332 CDD:304433 77/311 (25%)
7tm_1 67..321 CDD:278431 70/287 (24%)
Taar1NP_599155.1 7tm_4 30..>164 CDD:304433 38/140 (27%)
7tm_1 39..301 CDD:278431 70/287 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24249
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.