DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mAChR-C and si:ch211-238p8.31

DIOPT Version :9

Sequence 1:NP_572358.1 Gene:mAChR-C / 31626 FlyBaseID:FBgn0029909 Length:371 Species:Drosophila melanogaster
Sequence 2:XP_017213583.1 Gene:si:ch211-238p8.31 / 108191511 ZFINID:ZDB-GENE-091113-50 Length:335 Species:Danio rerio


Alignment Length:282 Identity:67/282 - (23%)
Similarity:130/282 - (46%) Gaps:33/282 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 FLFVLILGG-----NILTIVAVRTCRHLRSVISNLFILSLAVSDFCVGL-ALPYHLV------FY 111
            ::|..:|..     |:|.|:::...:.|.:. :|:.||||||:|..||| .:|...:      :|
Zfish    35 YVFFSLLSAWTVFLNLLVIISISHFKKLHTP-TNMIILSLAVTDMFVGLIVIPVKAIKLIERCWY 98

  Fly   112 MGSDIGAMRGPCLLRFFLLICACCVSMLTLISIAVDRYIAVVYALHYRRYMTRRVAYSIIIFNWC 176
            .|...      |.|...::......|:..|:.||||||:||.:.|.|.:.:|.......|..:|.
Zfish    99 FGDTF------CGLFIIIIGVIFSASLSNLVLIAVDRYVAVCHPLLYPQKITMAKMLMSICLSWL 157

  Fly   177 LGALVALLPVFWNRWPD----AQAC--EFDEVLAPGYIAGVITPGFVIIWICMFLVYWRIMREAS 235
            ..:......:..|.:.|    ...|  |...:::..:|...::..|:...:.|..:|.||. .|.
Zfish   158 YYSAYNTALIINNGYFDTSNRTDMCNGECPVMVSFSWILTDLSMCFIFPCLIMITLYSRIF-FAV 221

  Fly   236 KQALRLRQSVVYNTDEATTMRNLLLHPDWKSVQIVVFIMGCFTLCWLPYFCVAIAQLFSICQSSS 300
            .|.:::..|:: ..|:.....::....:.|:...:..|:..:.||::||:..::     :..||:
Zfish   222 HQQVKVINSLM-KRDKCVMKGSVKRKSERKAALTLGIIVTIYLLCYIPYYICSL-----VIISST 280

  Fly   301 MIYKTTFSLAIANSALNPIIYS 322
            .:...|::: .|||.|||::|:
Zfish   281 ALNVLTWTM-YANSGLNPLVYA 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mAChR-CNP_572358.1 7tm_4 61..332 CDD:304433 67/280 (24%)
7tm_1 67..321 CDD:278431 64/271 (24%)
si:ch211-238p8.31XP_017213583.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24249
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.