DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mAChR-C and taar19c

DIOPT Version :9

Sequence 1:NP_572358.1 Gene:mAChR-C / 31626 FlyBaseID:FBgn0029909 Length:371 Species:Drosophila melanogaster
Sequence 2:XP_009303915.2 Gene:taar19c / 103911783 ZFINID:ZDB-GENE-060414-16 Length:353 Species:Danio rerio


Alignment Length:305 Identity:72/305 - (23%)
Similarity:123/305 - (40%) Gaps:79/305 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 FLFVLILGG-----NILTIVAVRTCRHLRSVISNLFILSLAVSDFCVGL-ALPYHLV------FY 111
            ::||.:|..     |:|.|:::...:.|.:. :|:.||||||:|..:|| .:|...|      :|
Zfish    53 YIFVSLLSVWTVILNLLVIISISHFKKLHTP-TNMIILSLAVTDLLIGLIVMPVEAVKLIDKCWY 116

  Fly   112 MGSDIGAMRGPCLLRFFLLICACCVSMLTLISIAVDRYIAVVYALHYRRYMTRRVAYSIIIFNW- 175
            .|...      |.|...|:......|:..|:.||||||:||.:.|.|.:.:|.......|..:| 
Zfish   117 FGDTF------CGLTLILIWVIPSASLSNLVLIAVDRYMAVCHPLLYPQKITMANTLMSICLSWV 175

  Fly   176 ------------------------CLGALVALLPVFWNRWPDAQACEFDEVLAPGYIAGVITPGF 216
                                    |.|....::...| |..|...|                  |
Zfish   176 YYSAYNTALLFDNGYFDTSHRTDVCYGDCSVMMSFSW-RVTDLFMC------------------F 221

  Fly   217 VIIWICMFLVYWRIMREASKQALRLRQSVVYNTDEATTMRNLLLHPDWKSVQIVVFIMGCFTLCW 281
            :...:.:..:|.||. .|..|.:::..|:: ...:.....::....:.|:...:..|:..:.|||
Zfish   222 IFPCVMIITLYLRIF-YAVHQQVKVINSLM-KGGKCVLKGSVKRKSESKAALTLGIIVTVYLLCW 284

  Fly   282 LPYFCVAIAQLFSIC----QSSSMIYKTTFSLAIANSALNPIIYS 322
            :||:         ||    .||::|...|: :..|||.|||::|:
Zfish   285 IPYY---------ICTLTVNSSTVISVLTW-IVYANSGLNPLVYA 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mAChR-CNP_572358.1 7tm_4 61..332 CDD:304433 72/303 (24%)
7tm_1 67..321 CDD:278431 68/294 (23%)
taar19cXP_009303915.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24249
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.