DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mAChR-C and taar18g

DIOPT Version :9

Sequence 1:NP_572358.1 Gene:mAChR-C / 31626 FlyBaseID:FBgn0029909 Length:371 Species:Drosophila melanogaster
Sequence 2:XP_009303908.2 Gene:taar18g / 100330560 ZFINID:ZDB-GENE-060413-11 Length:349 Species:Danio rerio


Alignment Length:289 Identity:75/289 - (25%)
Similarity:134/289 - (46%) Gaps:48/289 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 FLFVLILGG-----NILTIVAVRTCRHLRSVISNLFILSLAVSDFCVGLALP---YHLV---FYM 112
            ::|..:|..     |:|.|:::...:.|.:. :|:.||||||:|..:|||:|   :.||   :|.
Zfish    53 YVFFSLLSAWTVFLNLLVIISISHFKKLHTP-TNMIILSLAVNDLLIGLAMPIEAFRLVDTCWYF 116

  Fly   113 GSDIGAMRGPCLLRFFLLICA--CCVSMLTLISIAVDRYIAVVYALHYRRYMTRRVAYSIIIFNW 175
            |.        .....||::.|  ...|:..|:.||||||:||.::|.|.:.:|....:..|...|
Zfish   117 GE--------LFCGLFLIVMALLSSASLSNLVLIAVDRYVAVCHSLLYPQKITMTNVFVSICLCW 173

  Fly   176 CLGALVALLPVFWNRWPDA----QACEFDEVLAPGYIAGVITP--GFVIIWICMFLVYWRIMREA 234
            ........:.|..|.:.|.    :.|..:.:|...:...:|..  .|::..:.|..||.||...|
Zfish   174 SFSLTYCTVFVVNNTYLDTSSRKRVCYGECILHFSFTYVIIDEIYSFLLPCVVMITVYLRIFCVA 238

  Fly   235 SKQALRLRQSVVYN---TDEATTMRNLLLHPDWKSVQIVVFIMGCFTLCWLPYFCVAIAQLFSIC 296
            .|| :::..|::..   ..|.:..|.    .:.|:...:..::..:.||::||:.:::..::|  
Zfish   239 IKQ-VKVINSLMKGGKCVKEGSVKRK----SEHKAALTLGIVVTVYLLCYIPYYLISLTGVYS-- 296

  Fly   297 QSSSMIYKT-TFSL--AIANSALNPIIYS 322
                   || |:.|  ...||.|||:||:
Zfish   297 -------KTITYLLWTLYVNSGLNPLIYA 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mAChR-CNP_572358.1 7tm_4 61..332 CDD:304433 75/287 (26%)
7tm_1 67..321 CDD:278431 71/278 (26%)
taar18gXP_009303908.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24249
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.