DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mAChR-C and taar12a

DIOPT Version :9

Sequence 1:NP_572358.1 Gene:mAChR-C / 31626 FlyBaseID:FBgn0029909 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001076578.1 Gene:taar12a / 100034659 ZFINID:ZDB-GENE-041014-99 Length:343 Species:Danio rerio


Alignment Length:301 Identity:78/301 - (25%)
Similarity:132/301 - (43%) Gaps:38/301 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 LAINAFLFVLILG---GNILTIVAVRTCRHLRSVISNLFILSLAVSDFCVG-LALPYHLV----- 109
            :.:..||.::||.   ||::.|:::...:||:|. ::|.:.|||..|..:| |.:||.:|     
Zfish    43 VGLYVFLLLMILTTVFGNLMIIISISHFKHLQSP-THLIVQSLAACDCLMGSLVMPYSMVRSVEG 106

  Fly   110 -FYMGSDIGAMRGPCLLRFFLLICACCVSMLTLISIAVDRYIAVVYALHYRRYMTRRVAYSIIIF 173
             :|:|..:      |.:.|...:..|..|:|.|..|:||||:|:...|.|:..:|.......|||
Zfish   107 CWYLGDVV------CKVHFSFDVTFCISSLLHLCLISVDRYLAICDPLRYKIRVTNTTMTVFIIF 165

  Fly   174 NWCLGALVALLPVFWNRWPDAQACEFDEVLAPGYIAG----------VITP--GFVIIWICMFLV 226
            .|....:.:...||    ....|...:.::...|..|          .:.|  .|.|....|..:
Zfish   166 IWLFSVVYSFSIVF----SGITAVGLEMLILQTYCVGSCVLFFNKEWAVYPFLTFFITGAIMSSL 226

  Fly   227 YWRIMREASKQALRLRQSVVYNTDEATTMRNLLLHPDWKSVQIVVFIMGCFTLCWLPYFCVAIAQ 291
            |.:|...|.|.|..:.:.|........:.:.     :.|:.:.:..:||.|..|||||.......
Zfish   227 YMKIFHVARKHAKVMSERVKGGLKSQRSAQR-----ERKAAKTLAIVMGVFMFCWLPYCAFTALY 286

  Fly   292 LFSICQSSSMIYKTTFSLAIANSALNPIIYSWKNSGFRRAF 332
            .|....:|:.::...|..|..||:.||:||.:....|::||
Zfish   287 PFFTFLNSAEVFDVLFWFAYFNSSCNPLIYGFFYPCFQKAF 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mAChR-CNP_572358.1 7tm_4 61..332 CDD:304433 74/292 (25%)
7tm_1 67..321 CDD:278431 69/272 (25%)
taar12aNP_001076578.1 7tm_4 57..328 CDD:304433 74/287 (26%)
7tm_1 59..316 CDD:278431 69/272 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24249
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.