DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mAChR-C and taar12b

DIOPT Version :9

Sequence 1:NP_572358.1 Gene:mAChR-C / 31626 FlyBaseID:FBgn0029909 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001076573.1 Gene:taar12b / 100034646 ZFINID:ZDB-GENE-041014-69 Length:337 Species:Danio rerio


Alignment Length:311 Identity:78/311 - (25%)
Similarity:127/311 - (40%) Gaps:70/311 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 LFVLILG---GNILTIVAVRTCRHLRSVISNLFILSLAVSDFCVG-LALPYHLV------FYMGS 114
            |.::||.   ||:|.|:::...:||:|. ::|.:.|||..|..:| |.:||.:|      :|:|.
Zfish    39 LLLMILTTVFGNLLIIISISHFKHLQSP-THLIVQSLAACDCLMGSLVMPYSMVRSVEGCWYLGD 102

  Fly   115 DIGAMRGPCLLRFFLLICACCVSMLTLISIAVDRYIAVVYALHYRRYMTRRVAYSIIIFNW---- 175
            .:      |.:...|.:..|..|:|.|..|:||||.|:...|.||..:|.......||..|    
Zfish   103 VV------CKVHSSLDMTFCMSSLLHLGLISVDRYWAICDPLRYRLRVTNTTVTVFIIVIWLFSF 161

  Fly   176 ------------------------CLGALVALLPVFWNRWPDAQACEFDEVLAPGYIAGVITPGF 216
                                    |:|:.:.|....|..:|          ....:|.|.|    
Zfish   162 IYNFSIVFSGITAVGLEMLILQTYCVGSCIVLFNKEWAVYP----------FLTFFITGAI---- 212

  Fly   217 VIIWICMFLVYWRIMREASKQALRLRQSVVYNTDEATTMRNLLLHPDWKSVQIVVFIMGCFTLCW 281
                  |..:|.:|...|.|.|..:.:.|.......::.:.     :.|:.:.:..:||.|..||
Zfish   213 ------MSSLYMKIFHVAQKHAKVMSERVTGGLKSQSSAQR-----ERKAAKTLAIVMGVFMFCW 266

  Fly   282 LPYFCVAIAQLFSICQSSSMIYKTTFSLAIANSALNPIIYSWKNSGFRRAF 332
            |||........|....:|:.::...|..|..||:.||:||.:....|::||
Zfish   267 LPYCAFTALYPFFTFLNSAEVFDVLFWFAYFNSSCNPVIYGFFYPCFQKAF 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mAChR-CNP_572358.1 7tm_4 61..332 CDD:304433 75/308 (24%)
7tm_1 67..321 CDD:278431 70/288 (24%)
taar12bNP_001076573.1 7tm_4 47..318 CDD:304433 75/303 (25%)
7tm_1 49..306 CDD:278431 70/288 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24249
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.