DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mAChR-C and taar12c

DIOPT Version :9

Sequence 1:NP_572358.1 Gene:mAChR-C / 31626 FlyBaseID:FBgn0029909 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001076564.1 Gene:taar12c / 100034601 ZFINID:ZDB-GENE-041014-66 Length:338 Species:Danio rerio


Alignment Length:330 Identity:85/330 - (25%)
Similarity:140/330 - (42%) Gaps:80/330 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 LAINAFLFVLILG---GNILTIVAVRTCRHLRSVISNLFILSLAVSDFCVG-LALPYHLV----- 109
            :|:...|.::||.   ||:|.|:::...:||:|. ::|.:.|||.||..:| |.:||.:|     
Zfish    33 VAMYVCLLLMILTTVFGNLLIIISISHFKHLQSP-THLIVRSLAASDCLLGSLVMPYSMVRSVEG 96

  Fly   110 -FYMGSDIGAMRGPCLLRFFLLICACCVSMLTLISIAVDRYIAVVYALHYRRYMTRRVAYSIIIF 173
             :|:|..:      |.:...|.:..|..|:|.|..|:||||.|:...|.||..:|........:|
Zfish    97 CWYLGDVV------CKVHSSLDMTFCISSLLHLGLISVDRYWAICDPLRYRLRVTNTTVTVFTVF 155

  Fly   174 NW----------------------------CLGALVALLPVFWNR-WPDAQACEFDEVLAPGYIA 209
            .|                            |:|:.|    :|:|: |              |.|.
Zfish   156 IWLFAFVYSFSVVFSGIAAVGLEMLILQTYCVGSCV----LFFNKEW--------------GLIC 202

  Fly   210 GVIT---PGFVIIWICMFLVYWRIMREASKQALRLRQSVVYNTDEATTMRNLLLHPDWKSVQIVV 271
            .::|   ||.:     |..:|.:|...|.|.|..:.:.|.......::.:.     :.|:.:.:.
Zfish   203 PILTFFLPGAI-----MSFLYMKIFHVARKHAKVMSERVTGGLKSQSSAQR-----ERKAAKTLA 257

  Fly   272 FIMGCFTLCWLPYFCVAIAQLFSICQSSSMIYKTTFSLAIANSALNPIIYSWKNSGFRRAF---V 333
            .:||.|..||||||.|.|...|....:.:.::......|..||..||:||.:....|::||   :
Zfish   258 IVMGVFMFCWLPYFTVTILGPFFNFATPADVFDALVWFAYLNSTCNPLIYGFFYPCFQKAFHILI 322

  Fly   334 QTLCC 338
            .|..|
Zfish   323 STYIC 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mAChR-CNP_572358.1 7tm_4 61..332 CDD:304433 79/312 (25%)
7tm_1 67..321 CDD:278431 74/292 (25%)
taar12cNP_001076564.1 7tm_4 47..318 CDD:304433 77/305 (25%)
7tm_1 49..307 CDD:278431 74/292 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24249
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.