DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mAChR-C and taar14j

DIOPT Version :9

Sequence 1:NP_572358.1 Gene:mAChR-C / 31626 FlyBaseID:FBgn0029909 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001076545.1 Gene:taar14j / 100034516 ZFINID:ZDB-GENE-041014-34 Length:320 Species:Danio rerio


Alignment Length:295 Identity:77/295 - (26%)
Similarity:136/295 - (46%) Gaps:47/295 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 LLWLAINAFLFVLILGGNILTIVAVRTCRHLRSVISNLFILSLAVSDFCVGL-ALPYHLVFYMGS 114
            :|::|. |.:.:|.:.||:|.|::|...:.|.:. :|:.|||||.||..||: .:|  |:|.:..
Zfish    19 ILYVAA-AAVALLTVCGNLLVIISVSHFKQLHTP-ANILILSLAASDLLVGVFVMP--LLFTLLI 79

  Fly   115 DIGAMRGP--CLLRFFLLICACCVSMLTLISIAVDRYIAVVYALHYRRYMTRRVAYSIIIFNWCL 177
            :...:.||  |.:..|:...|..||:.|:..|||||::|:.:...|...::..|.....:.||..
Zfish    80 ESCWIAGPVMCAVLKFVNFQATSVSVHTVSLIAVDRFLALSFPFFYSEKISLTVICIAALSNWLF 144

  Fly   178 GALVALLPVFWNRWPDAQACEFDEVLAPGY-------IAGVITPGFVIIWIC--MFLVYWRIMRE 233
            ........::.||       .|...:.||.       ::.:|....|.:..|  :.::|..:...
Zfish   145 SLFYNFTVLYINR-------HFTGFMCPGVCFFVIDEVSSLIDLLIVFVMPCTLIIILYTHVFVI 202

  Fly   234 ASKQALRLRQSVVYNTDEATTMRNLLL-HPDWKSVQIVVFIMGCFTLCWLPYFCVAIAQLFSICQ 297
            |.|.|..:|...|:|:.|::  :|.:. ..:.|:..::..::..|.||.|||:.           
Zfish   203 AKKHATAIRALQVHNSTESS--KNKISDKSERKAAMLLGILVFVFLLCLLPYYI----------- 254

  Fly   298 SSSMIYKTTFSLA----------IANSALNPIIYS 322
            :|.:|..||..|.          ..||.:|||||:
Zfish   255 TSLVISYTTVDLLHVRDVAVIFFFVNSTINPIIYA 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mAChR-CNP_572358.1 7tm_4 61..332 CDD:304433 74/285 (26%)
7tm_1 67..321 CDD:278431 71/276 (26%)
taar14jNP_001076545.1 7tm_1 34..288 CDD:278431 71/276 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24249
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.