DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mAChR-C and taar13e

DIOPT Version :9

Sequence 1:NP_572358.1 Gene:mAChR-C / 31626 FlyBaseID:FBgn0029909 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001076512.1 Gene:taar13e / 100034381 ZFINID:ZDB-GENE-041014-70 Length:341 Species:Danio rerio


Alignment Length:331 Identity:81/331 - (24%)
Similarity:149/331 - (45%) Gaps:50/331 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 HQNATETPTEITLQATSFGAGHLLWLAINAFLFVLILGGNILTIVAVRTCRHLRSVISNLFILSL 93
            |..:|:|               :::|.:.:.:.|.|| ||.:.|:::...:.|::. :|:.::||
Zfish    27 HHVSTQT---------------VVYLVLASAMTVTIL-GNSVVIISIAHFKQLQTP-TNILVMSL 74

  Fly    94 AVSDFCVGL-ALPYHLV------FYMGSDIGAMRGPCLLRFFLLICACCVSMLTLISIAVDRYIA 151
            |::|..:|| .:|:.::      :|.|...      |||.....:....||:..||.|||||:.|
Zfish    75 ALADLLLGLVVMPFSMIRSVDGCWYYGETF------CLLHSSFDMFLTSVSIFHLIFIAVDRHQA 133

  Fly   152 VVYALHYRRYMTRRVAYSIIIFNWCLGALVALLPVFWNRWPDAQACEFDEVLAPGYIAGVITPGF 216
            |.:.|.|...:|..||:.::|.:|.:.|..:...|:    ..|.....:|.:...|..|..|..|
Zfish   134 VCFPLQYPTMITIPVAWVMVIISWSMAAFYSYGLVY----SKANVEGLEEYIESIYCMGGCTLLF 194

  Fly   217 VIIW------ICMFL-------VYWRIMREASKQALRLRQSVVYNTDEATTMRNLLLHPDWKSVQ 268
            ..:|      :..||       :|.||...|.|.|.:|.::   |..:...:.......:.|:.:
Zfish   195 NALWGAIDTLVAFFLPCFVMIGLYARIFMIAKKHARKLGEA---NQHDNENLFKSSRRSERKAAK 256

  Fly   269 IVVFIMGCFTLCWLPYFCVAIAQLFSICQSSSMIYKTTFSLAIANSALNPIIYSWKNSGFRRAFV 333
            .:..::|.|.:||||:|..::...:....:..::::....|...|||:|||||......||:...
Zfish   257 TLGIVVGAFVICWLPFFINSMMDPYINFSTPGVLFEAFVWLGYMNSAINPIIYGLFYPWFRKTLY 321

  Fly   334 QTLCCR 339
            ..:..|
Zfish   322 LIITLR 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mAChR-CNP_572358.1 7tm_4 61..332 CDD:304433 76/290 (26%)
7tm_1 67..321 CDD:278431 69/273 (25%)
taar13eNP_001076512.1 7tm_4 43..>269 CDD:304433 60/240 (25%)
7tm_1 49..309 CDD:278431 69/273 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24249
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.