DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mAChR-C and taar15

DIOPT Version :9

Sequence 1:NP_572358.1 Gene:mAChR-C / 31626 FlyBaseID:FBgn0029909 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001076508.1 Gene:taar15 / 100034377 ZFINID:ZDB-GENE-041014-50 Length:328 Species:Danio rerio


Alignment Length:335 Identity:82/335 - (24%)
Similarity:138/335 - (41%) Gaps:70/335 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 HLLWLAINAFLF-------VLILGGNILTIVAVRTCRHLRSVISNLFILSLAVSDFCVGLAL-PY 106
            ||.:  :|.|||       ||.:.||:|.||::...:.|.:. :||.|||||:||..||:.| |.
Zfish    21 HLSY--VNVFLFLYISAISVLTVCGNLLVIVSITVFKQLHTP-TNLLILSLAISDLLVGICLMPV 82

  Fly   107 HLV------FYMGSDIGAMRGPCLLRFFLLICACCVSMLTLISIAVDRYIAVVYALHYRRYMTRR 165
            ..:      ||||      :..|.:...::......|::.::.:|:|||.||...|.|...||.|
Zfish    83 ESIRSINSCFYMG------KSHCHIFHSIMSIVGSASLMNIMLVAIDRYFAVCNPLLYMSKMTIR 141

  Fly   166 VAYSIIIFNWCLGALVALLPV---------------------FWNRWPDAQACEFDEVLAPGYIA 209
            .|...:...|.:.....|:||                     ..|.|..|.              
Zfish   142 KALICVCLGWTVSICYNLVPVNLGNSDPTGAVVVCLRECAVAVSNSWGPAD-------------- 192

  Fly   210 GVITPGFVIIWICMFLVYWRIMREASKQALRLRQSVVYNTDEATTMRNLLLHPDWKSVQIVVFIM 274
              :...|:...|.|.::|.||:..|.|||..:......|..:.:....:   ...|::..::|: 
Zfish   193 --LIVSFIAPCIMMLILYTRILTVALKQAKAISNMTKKNGSQPSRKSEV---KATKTLSTIIFV- 251

  Fly   275 GCFTLCWLPYFCVAI-AQLFSICQSSSMIYKTTFSLAIANSALNPIIYSWKNSGFRRAFVQTLCC 338
              :.:||:|::.:.: .:.|:....|...:...|   ..||.:||.||:.....|:|:....:..
Zfish   252 --YFICWIPWYVIMLNMEQFNKLPVSISAFLCLF---YTNSCINPFIYAISYPWFKRSVKLVVSL 311

  Fly   339 RTARQCEDQL 348
            |..:...:||
Zfish   312 RILQTATNQL 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mAChR-CNP_572358.1 7tm_4 61..332 CDD:304433 74/306 (24%)
7tm_1 67..321 CDD:278431 67/282 (24%)
taar15NP_001076508.1 7tm_4 37..>135 CDD:304433 34/104 (33%)
7tm_1 43..294 CDD:278431 67/282 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24249
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.