DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mAChR-C and taar19p

DIOPT Version :9

Sequence 1:NP_572358.1 Gene:mAChR-C / 31626 FlyBaseID:FBgn0029909 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001186843.1 Gene:taar19p / 100003265 ZFINID:ZDB-GENE-091116-10 Length:335 Species:Danio rerio


Alignment Length:290 Identity:66/290 - (22%)
Similarity:130/290 - (44%) Gaps:40/290 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 HLLWLAINAFLFVLILGGNILTIVAVRTCRHLRSVISNLFILSLAVSDFCVGL-ALPYHLV---- 109
            ::|:..::|:...|    |:|.|:::...:.|.:. :|:.||||||:|..:|| .:|...:    
Zfish    35 YVLFSLLSAWTVFL----NLLVIISISHFKKLHTP-TNMIILSLAVTDLLIGLIVMPIQAIRLIE 94

  Fly   110 --FYMGSDIGAMRGPCLLRFFLLICACCVSMLTLISIAVDRYIAVVYALHYRRYMTRRVAYSIII 172
              :|.|..:      |.:...::......|...|:.||||||:||.:.|.|.:.:|.......|.
Zfish    95 TCWYFGDTL------CGINLIIIGVIFSASFSNLVLIAVDRYVAVCHPLLYPQKITMAKMLMCIC 153

  Fly   173 FNWCLGALVALLPVFWNRWPD----AQACEFD--EVLAPGYIAGVITPGFVIIWICMFLVYWRIM 231
            .:|...:......|..|.:.|    ...|..|  .:::..::...:...|:...:.|..:|.||.
Zfish   154 LSWVYYSAYNTGLVINNGYFDTSHRTDVCYGDCSVIMSFSWLVTDLCLSFIFPCVIMITLYLRIF 218

  Fly   232 REASKQALRLRQSVVYNTDEATTMRNLLLHPDWKSVQIVVFIMGCFTLCWLPYFCVAIAQLFSIC 296
            ....:| :::..|:: ...:..|..::....:.|:...:..|:..:.||::||:         ||
Zfish   219 YVVHQQ-VKVINSLM-KGGKCVTKGSVKRKSESKAALTLGIIVLVYLLCYIPYY---------IC 272

  Fly   297 QSSSMIYKTTFSL----AIANSALNPIIYS 322
             :.|:...||.::    ...||.|||::|:
Zfish   273 -TLSVNSSTTITVLEWTVYTNSGLNPLVYA 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mAChR-CNP_572358.1 7tm_4 61..332 CDD:304433 64/279 (23%)
7tm_1 67..321 CDD:278431 62/270 (23%)
taar19pNP_001186843.1 7tm_4 46..>219 CDD:304433 44/183 (24%)
7tm_1 49..300 CDD:278431 62/269 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24249
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.