DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nonC and Pik3cb

DIOPT Version :9

Sequence 1:NP_001284967.1 Gene:nonC / 31625 FlyBaseID:FBgn0263968 Length:3218 Species:Drosophila melanogaster
Sequence 2:NP_445933.1 Gene:Pik3cb / 85243 RGDID:620917 Length:1070 Species:Rattus norvegicus


Alignment Length:402 Identity:91/402 - (22%)
Similarity:148/402 - (36%) Gaps:100/402 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly  1836 EAWDKLKQLYHILQSNMI---RGSG-----STLKMQSISPVLCGIGRMRISMPGLDAHGPDGDQV 1892
            ||.:|||.|..:::.|.:   |..|     :.||..:....|.            |...|....|
  Rat   714 EALNKLKTLNSLIKLNAMKLNRAKGKEAMHTCLKQSAYREALS------------DLQSPLNPCV 766

  Fly  1893 YIESVESSVC-VLPTKTKPKKVAF----YGSNGQRYTFLFKGMEDLHLDERIMQFLSISNAIMAC 1952
            .:..:....| .:.:|.||..:.:    :|.:.  ...:||..:||..|...:|.|.:.:.:.  
  Rat   767 ILSELYVEKCRYMDSKMKPLWLVYSNRAFGEDA--VGVIFKNGDDLRQDMLTLQMLRLMDLLW-- 827

  Fly  1953 RSDAPGNGCYRAHHYSVIPLGPQSGLISWVDGVTPVFALYKKWQQRRSQVAGNAGAGAVANVPRR 2017
             .:|..:  .|...|..:..|.:||||..|.....:..:    |...|.||..|.          
  Rat   828 -KEAGLD--LRMLPYGCLATGDRSGLIEVVSTSETIADI----QLNSSNVAATAA---------- 875

  Fly  2018 FTDLFYNKLSPLLAKHNMQVSDPRRQWPISVLLQVLDELSQETPNDLLARELWCQAGNAAEWRQS 2082
                 :||             |....|           |.:....|.|.|              :
  Rat   876 -----FNK-------------DALLNW-----------LKEYNSGDDLDR--------------A 897

  Fly  2083 VRRFVRCMSVMSMIGYVIGLGDRHLDNVLINLGSGDIVHIDYNVC---FEKGRTLRIPEKVPFRL 2144
            :..|....:...:..||:|:||||.||:::. .:|.:.|||:...   |:....:: .|:|||.|
  Rat   898 IEEFTLSCAGYCVASYVLGIGDRHSDNIMVK-KTGQLFHIDFGHILGNFKSKFGIK-RERVPFIL 960

  Fly  2145 TQNLVQAM--GITGIE---GPFRLGCEYVLKVMRKERETLLTLLEAFVYDPLVDWTTNDDAQALR 2204
            |.:.:..:  |.||..   |.||..||....::|:.....:||....:...|.:.|:..|.|.|:
  Rat   961 TYDFIHVIQQGKTGNTEKFGRFRQCCEDAYLILRRHGNLFITLFALMLTAGLPELTSVKDIQYLK 1025

  Fly  2205 RSLN-AKLQESA 2215
            .||. .|.:|.|
  Rat  1026 DSLALGKSEEEA 1037

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nonCNP_001284967.1 SMG1 571..1140 CDD:292413
Rapamycin_bind 1738..1845 CDD:285924 5/8 (63%)
PIKKc_SMG1 1894..2196 CDD:270714 67/314 (21%)
FATC 3189..3217 CDD:280430
Pik3cbNP_445933.1 PI3K_p85B 41..118 CDD:197539
PI3K_rbd 180..288 CDD:197540
C2_PI3K_class_I_beta_delta 324..501 CDD:176075
Nuclear localization signal (NLS). /evidence=ECO:0000250 410..418
PI3Ka_I 532..702 CDD:238444
PI3Kc_IA_beta 706..1067 CDD:270717 91/402 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.