DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nonC and BOLA2

DIOPT Version :9

Sequence 1:NP_001284967.1 Gene:nonC / 31625 FlyBaseID:FBgn0263968 Length:3218 Species:Drosophila melanogaster
Sequence 2:NP_001307508.1 Gene:BOLA2 / 552900 HGNCID:29488 Length:123 Species:Homo sapiens


Alignment Length:104 Identity:20/104 - (19%)
Similarity:41/104 - (39%) Gaps:26/104 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly  1015 LVSCQEADSLRGLRLWARGKSCKSYKWLK----YAADQAAGKRESALAGYRTILAEKELQSELEP 1075
            :.|.:..|..:. ||...|.:..:|..::    :.|:.|..:::.::||                
Human     1 MASAKSLDRWKA-RLLEGGSTALTYALVRAEVSFPAEVAPVRQQGSVAG---------------- 48

  Fly  1076 HTRQFVVSQMMQCLQDLGQWSQLVELKQQQMTRPEDREL 1114
             .|..||| ::.|   ...|:..:||..:.:.....|:|
Human    49 -ARAGVVS-LLGC---RSSWTAAMELSAEYLREKLQRDL 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nonCNP_001284967.1 SMG1 571..1140 CDD:292413 20/104 (19%)
Rapamycin_bind 1738..1845 CDD:285924
PIKKc_SMG1 1894..2196 CDD:270714
FATC 3189..3217 CDD:280430
BOLA2NP_001307508.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.