DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atx-1 and atxn1b

DIOPT Version :9

Sequence 1:NP_572356.1 Gene:Atx-1 / 31624 FlyBaseID:FBgn0029907 Length:230 Species:Drosophila melanogaster
Sequence 2:XP_005158216.1 Gene:atxn1b / 565841 ZFINID:ZDB-GENE-061218-2 Length:827 Species:Danio rerio


Alignment Length:142 Identity:63/142 - (44%)
Similarity:89/142 - (62%) Gaps:6/142 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 RQP-PSLPPPSQQHWSSNGFSDDSASC---FRRGSYIELASGAMRRVEDIRTEDFIQSALRSQLF 78
            |.| |:.||.|....||.  |..:|..   |.:||.|:||.|.::||||:|||||:|||..|...
Zfish   538 RSPVPATPPISTSPHSSP--SSPTAGLPPFFMKGSIIQLADGELKRVEDLRTEDFVQSAEVSGEL 600

  Fly    79 ELREATVVRIDWSGCPSLVTLTFSYDTHHAKMDLQVQPGHPMFVYGQGWASCDPQLSLQLYELKC 143
            ::..:||.||:.||.|:.|.:.||...:.|::.::|...:|.||:||||:||.|..:.||..|.|
Zfish   601 KIDSSTVERIEGSGTPNAVIIQFSVGENKAQVCVEVLVEYPFFVFGQGWSSCCPDRTTQLLALSC 665

  Fly   144 QQLQVGDICLSL 155
            .:|.|||:|:||
Zfish   666 AKLSVGDVCISL 677

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atx-1NP_572356.1 AXH 43..158 CDD:197779 53/116 (46%)
atxn1bXP_005158216.1 ATXN-1_C 363..404 CDD:289324
AXH 572..678 CDD:285689 50/106 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577664
Domainoid 1 1.000 110 1.000 Domainoid score I6247
eggNOG 1 0.900 - - E1_KOG4053
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002655
OrthoInspector 1 1.000 - - otm24900
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.740

Return to query results.
Submit another query.