DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atx-1 and Atxn1l

DIOPT Version :9

Sequence 1:NP_572356.1 Gene:Atx-1 / 31624 FlyBaseID:FBgn0029907 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_001074399.1 Gene:Atxn1l / 52335 MGIID:3694797 Length:687 Species:Mus musculus


Alignment Length:172 Identity:65/172 - (37%)
Similarity:92/172 - (53%) Gaps:23/172 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 PSLPPPSQQHWSSNGFSDDSASCFRRGSYIELASGAMRRVEDIRTEDFIQSALRSQLFELREATV 85
            |:.||.:..|..|:         |.:|:.|:||:|.::||||::|:||::||..|...::..:||
Mouse   453 PTPPPVTSSHLPSH---------FMKGAIIQLATGELKRVEDLQTQDFVRSAEVSGGLKIDSSTV 508

  Fly    86 VRIDWSGCPSLVTLTFSYDTHHAKMDLQVQPGHPMFVYGQGWASCDPQLSLQLYELKCQQLQVGD 150
            |.|..|..|..|.|.|......:|:.::|.|.||.|||||||:||.|..:.||:.|.|.:|||||
Mouse   509 VDIQESQWPGFVMLHFVVGEQQSKVSIEVPPEHPFFVYGQGWSSCSPGRTAQLFSLPCHRLQVGD 573

  Fly   151 ICL-----SLVPNEQPAAPCPPQPAPPPPCPPPSLPPSMEMP 187
            :|:     ||..|....|.|         .||..|....|.|
Mouse   574 VCISISLQSLNSNSVSQASC---------APPGQLGTPRERP 606

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atx-1NP_572356.1 AXH 43..158 CDD:197779 52/119 (44%)
Atxn1lNP_001074399.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..46
Interaction with NCOR2 and ATXN1. /evidence=ECO:0000250 20..197
Self-association. /evidence=ECO:0000250 20..197
PTZ00395 <111..>302 CDD:185594
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 185..223
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 261..294
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 356..379
AXH 467..578 CDD:369920 50/110 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 587..649 7/29 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834659
Domainoid 1 1.000 111 1.000 Domainoid score I6251
eggNOG 1 0.900 - - E1_KOG4053
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4678
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002655
OrthoInspector 1 1.000 - - otm43014
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3533
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.720

Return to query results.
Submit another query.