DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atx-1 and ATXN1L

DIOPT Version :9

Sequence 1:NP_572356.1 Gene:Atx-1 / 31624 FlyBaseID:FBgn0029907 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_001131147.1 Gene:ATXN1L / 342371 HGNCID:33279 Length:689 Species:Homo sapiens


Alignment Length:219 Identity:77/219 - (35%)
Similarity:111/219 - (50%) Gaps:35/219 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 PSLPPPSQQHWSSNGFSDDSASCFRRGSYIELASGAMRRVEDIRTEDFIQSALRSQLFELREATV 85
            |:.||.:..|..|:         |.:|:.|:||:|.::||||::|:||::||..|...::..:||
Human   455 PTPPPITSSHLPSH---------FMKGAIIQLATGELKRVEDLQTQDFVRSAEVSGGLKIDSSTV 510

  Fly    86 VRIDWSGCPSLVTLTFSYDTHHAKMDLQVQPGHPMFVYGQGWASCDPQLSLQLYELKCQQLQVGD 150
            |.|..|..|..|.|.|......:|:.::|.|.||.|||||||:||.|..:.||:.|.|.:|||||
Human   511 VDIQESQWPGFVMLHFVVGEQQSKVSIEVPPEHPFFVYGQGWSSCSPGRTTQLFSLPCHRLQVGD 575

  Fly   151 ICL-----SLVPNEQPAAPC--PPQPAPPPPCPPPSLPPSMEM--------PVPMGS-------P 193
            :|:     ||..|....|.|  |.|..||...|..::..|.|:        |...||       |
Human   576 VCISISLQSLNSNSVSQASCAPPSQLGPPRERPERTVLGSRELCDSEGKSQPAGEGSRVVEPSQP 640

  Fly   194 PTGSYGFLP---FKHPYEMYAQMA 214
            .:|:....|   |:. |.|..:.|
Human   641 ESGAQACWPAPSFQR-YSMQGEEA 663

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atx-1NP_572356.1 AXH 43..158 CDD:197779 52/119 (44%)
ATXN1LNP_001131147.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..46
Interaction with NCOR2 and ATXN1. /evidence=ECO:0000269|PubMed:16121196 20..197
Self-association 20..197
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 185..223
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 242..297
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 357..405
AXH 475..579 CDD:285689 48/103 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 617..647 6/29 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144536
Domainoid 1 1.000 111 1.000 Domainoid score I6242
eggNOG 1 0.900 - - E1_KOG4053
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002655
OrthoInspector 1 1.000 - - otm40942
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3533
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.770

Return to query results.
Submit another query.