DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atx-1 and Atxn1

DIOPT Version :9

Sequence 1:NP_572356.1 Gene:Atx-1 / 31624 FlyBaseID:FBgn0029907 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_001186234.1 Gene:Atxn1 / 20238 MGIID:104783 Length:799 Species:Mus musculus


Alignment Length:161 Identity:59/161 - (36%)
Similarity:88/161 - (54%) Gaps:34/161 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 PSLPPPSQQHWSSNGFSDDSASCFRRGSYIELASGAMRRVEDIRTEDFIQSALRSQLFELREATV 85
            |:|||                 .|.:||.|:||:|.:::|||::||||||||..|...::..:||
Mouse   544 PTLPP-----------------YFMKGSIIQLANGELKKVEDLKTEDFIQSAEISNDLKIDSSTV 591

  Fly    86 VRIDWSGCPSLVTLTFSYDTHHAKMDL--------QVQPGHPMFVYGQGWASCDPQLSLQLYELK 142
            .||:.|..|.:..:.|:...|.|::.|        :|...:|.||:||||:||.|:.:.||::|.
Mouse   592 ERIEESHSPGVAVIQFAVGEHRAQVTLTRVIQVSVEVLVEYPFFVFGQGWSSCCPERTSQLFDLP 656

  Fly   143 CQQLQVGDICLSL---------VPNEQPAAP 164
            |.:|.|||:|:||         |...||..|
Mouse   657 CSKLSVGDVCISLTLKNLKNGSVKKGQPVDP 687

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atx-1NP_572356.1 AXH 43..158 CDD:197779 52/131 (40%)
Atxn1NP_001186234.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..36
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 187..240
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 298..402
ATXN-1_C 391..421 CDD:289324
Self-association. /evidence=ECO:0000250|UniProtKB:P54253 470..580 22/52 (42%)
AXH 549..672 CDD:197779 51/122 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 744..782
Nuclear localization signal. /evidence=ECO:0000269|PubMed:9778246 778..781
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834660
Domainoid 1 1.000 111 1.000 Domainoid score I6251
eggNOG 1 0.900 - - E1_KOG4053
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002655
OrthoInspector 1 1.000 - - otm43014
orthoMCL 1 0.900 - - OOG6_109233
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3533
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.670

Return to query results.
Submit another query.