DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atx-1 and K04F10.1

DIOPT Version :9

Sequence 1:NP_572356.1 Gene:Atx-1 / 31624 FlyBaseID:FBgn0029907 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_491837.2 Gene:K04F10.1 / 187002 WormBaseID:WBGene00019394 Length:299 Species:Caenorhabditis elegans


Alignment Length:229 Identity:57/229 - (24%)
Similarity:101/229 - (44%) Gaps:58/229 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 DPIGRQPPSLPP---------PSQQHWSSNGFSDDSASCFRRGSYIELASGAMRRVEDIRTEDFI 69
            ||   ||.:..|         |:..::.::         |.||:.:.:|:|.:::|||:.::||:
 Worm    95 DP---QPSTSEPSIAFEMGTIPASTYYPTH---------FMRGTQLNVANGNIKKVEDLSSDDFL 147

  Fly    70 QSALRSQLFELREATVVRIDWSGCPSLVTLTFSYDTHHAKMDLQVQPGHPMFVYGQGWASCDPQL 134
            :.|..|. ..:..|:|::...|...| ||:.|........:.|:.|..||.||.|:||.||:|:.
 Worm   148 RCAAESD-DVIVNASVIKSIKSTAGS-VTIIFETGIEKQLIPLKCQVEHPFFVLGKGWCSCNPRK 210

  Fly   135 SLQLYELKCQQLQVGDICLSLVPNEQPAAPCPPQPAPPPPCPPPSLPPSMEMPVPMGSPPTGSYG 199
            |.:.|.|.|:.|||.|:|:.|..||.....|                               :..
 Worm   211 SGENYGLDCEILQVDDVCIVLTRNEDKITDC-------------------------------AVD 244

  Fly   200 FLPFKHPYEMYAQMAS----FVAVYTQHMMGKLN 229
            .:..:...|:::|.|:    .|.||.:.:.|:::
 Worm   245 IVTAERDLELFSQRAALKEQLVDVYYERVSGRVS 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atx-1NP_572356.1 AXH 43..158 CDD:197779 41/114 (36%)
K04F10.1NP_491837.2 AXH 121..234 CDD:197779 41/123 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158305
Domainoid 1 1.000 75 1.000 Domainoid score I5931
eggNOG 1 0.900 - - E1_KOG4053
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4678
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002655
OrthoInspector 1 1.000 - - oto17524
orthoMCL 1 0.900 - - OOG6_109233
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3533
SonicParanoid 1 1.000 - - X6160
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.620

Return to query results.
Submit another query.