DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atx-1 and LOC103694328

DIOPT Version :9

Sequence 1:NP_572356.1 Gene:Atx-1 / 31624 FlyBaseID:FBgn0029907 Length:230 Species:Drosophila melanogaster
Sequence 2:XP_008770785.2 Gene:LOC103694328 / 103694328 RGDID:9319286 Length:679 Species:Rattus norvegicus


Alignment Length:172 Identity:65/172 - (37%)
Similarity:92/172 - (53%) Gaps:23/172 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 PSLPPPSQQHWSSNGFSDDSASCFRRGSYIELASGAMRRVEDIRTEDFIQSALRSQLFELREATV 85
            |:.||.:..|..|:         |.:|:.|:||:|.::||||::|:||::||..|...::..:||
  Rat   445 PTPPPVTSSHLPSH---------FMKGAIIQLATGELKRVEDLQTQDFVRSAEVSGGLKIDSSTV 500

  Fly    86 VRIDWSGCPSLVTLTFSYDTHHAKMDLQVQPGHPMFVYGQGWASCDPQLSLQLYELKCQQLQVGD 150
            |.|..|..|..|.|.|......:|:.::|.|.||.|||||||:||.|..:.||:.|.|.:|||||
  Rat   501 VDIQESQWPGFVMLHFVVGEQQSKVSIEVPPEHPFFVYGQGWSSCSPGRTAQLFSLPCHRLQVGD 565

  Fly   151 ICL-----SLVPNEQPAAPCPPQPAPPPPCPPPSLPPSMEMP 187
            :|:     ||..|....|.|         .||..|....|.|
  Rat   566 VCISISLQSLNSNSVSQASC---------APPGQLGTPRERP 598

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atx-1NP_572356.1 AXH 43..158 CDD:197779 52/119 (44%)
LOC103694328XP_008770785.2 AXH 465..569 CDD:285689 48/103 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338240
Domainoid 1 1.000 111 1.000 Domainoid score I6099
eggNOG 1 0.900 - - E1_KOG4053
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002655
OrthoInspector 1 1.000 - - otm45078
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.740

Return to query results.
Submit another query.