DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atx-1 and atxn1l

DIOPT Version :9

Sequence 1:NP_572356.1 Gene:Atx-1 / 31624 FlyBaseID:FBgn0029907 Length:230 Species:Drosophila melanogaster
Sequence 2:XP_002937622.1 Gene:atxn1l / 100495371 XenbaseID:XB-GENE-5818895 Length:698 Species:Xenopus tropicalis


Alignment Length:156 Identity:61/156 - (39%)
Similarity:89/156 - (57%) Gaps:25/156 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 RQPP---SLPPPSQQHWSSNGFSDDSASCFRRGSYIELASGAMRRVEDIRTEDFIQSALRSQLFE 79
            :|||   :||                 |.|.:|:.|:||:|.:::|||::|:||::||..|...:
 Frog   463 KQPPHSTALP-----------------SHFMKGAIIQLATGELKKVEDLQTQDFVRSAEVSGGLK 510

  Fly    80 LREATVVRIDWSGCPSLVTLTFSYDTHHAKMDLQVQPGHPMFVYGQGWASCDPQLSLQLYELKCQ 144
            :..:|||.|..|..|..|||.|......:|:.|.|.|.||.|||||||:||.|:.:.||:.|.|.
 Frog   511 IDSSTVVDIQESQWPGFVTLHFIVGEQQSKVCLDVPPEHPFFVYGQGWSSCSPRQTAQLFALPCH 575

  Fly   145 QLQVGDICLSL-----VPNEQPAAPC 165
            :|||||:|:|:     |.|:.....|
 Frog   576 RLQVGDVCISISLQSAVKNDASTVSC 601

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atx-1NP_572356.1 AXH 43..158 CDD:197779 53/119 (45%)
atxn1lXP_002937622.1 AXH 475..586 CDD:369920 51/110 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 112 1.000 Domainoid score I6130
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002655
OrthoInspector 1 1.000 - - otm48137
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3533
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.