DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atx-1 and atxn1

DIOPT Version :9

Sequence 1:NP_572356.1 Gene:Atx-1 / 31624 FlyBaseID:FBgn0029907 Length:230 Species:Drosophila melanogaster
Sequence 2:XP_002932738.1 Gene:atxn1 / 100492711 XenbaseID:XB-GENE-982144 Length:792 Species:Xenopus tropicalis


Alignment Length:135 Identity:51/135 - (37%)
Similarity:84/135 - (62%) Gaps:17/135 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 PSLPPPSQQHWSSNGFSDDSASCFRRGSYIELASGAMRRVEDIRTEDFIQSALRSQLFELREATV 85
            |:|||                 .|.:||.|:||:|.:::|||::|:||||||..|...::..:||
 Frog   551 PTLPP-----------------YFMKGSIIQLANGELKKVEDLKTDDFIQSADISNDLKIDSSTV 598

  Fly    86 VRIDWSGCPSLVTLTFSYDTHHAKMDLQVQPGHPMFVYGQGWASCDPQLSLQLYELKCQQLQVGD 150
            .||:.|..|.:..:.|:...|.:::.::|...:|.||:||||:||.|:.:.|:::|.|.:|.|||
 Frog   599 ERIESSHSPGIAVVQFAVGEHRSQVSVEVLIEYPFFVFGQGWSSCSPERTSQMFDLPCSKLSVGD 663

  Fly   151 ICLSL 155
            :|:||
 Frog   664 VCISL 668

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atx-1NP_572356.1 AXH 43..158 CDD:197779 47/113 (42%)
atxn1XP_002932738.1 ATXN-1_C 382..426 CDD:403666
AXH 557..668 CDD:400701 45/110 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 112 1.000 Domainoid score I6130
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002655
OrthoInspector 1 1.000 - - otm48137
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3533
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.