DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nf-YC and Chrac1

DIOPT Version :9

Sequence 1:NP_572354.1 Gene:Nf-YC / 31622 FlyBaseID:FBgn0029905 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_444298.1 Gene:Chrac1 / 93696 MGIID:2135796 Length:129 Species:Mus musculus


Alignment Length:104 Identity:33/104 - (31%)
Similarity:48/104 - (46%) Gaps:11/104 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 LPLARIKKIMKLDENAKMIAGEAPLLFAKACEYFIQELTMHAWVHTEESRRRTLQRSDIAQAIAN 218
            |||:||:.|||.......|..||.:|.|||.|.|:|.|...::.|.....::.|..||:|....:
Mouse    19 LPLSRIRVIMKSSPEVSSINQEALVLTAKATELFVQYLATCSYRHGSGKAKKALTYSDLASTAED 83

  Fly   219 YDQFDFLIDIVPR-----------EEIKPSSAQKTKDGS 246
            .:...||.||:|:           :|.:........|||
Mouse    84 SETLQFLADILPKKILASKYLKMLKEKREEEEDNEDDGS 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nf-YCNP_572354.1 HAP5 <130..>246 CDD:227533 31/102 (30%)
Chrac1NP_444298.1 H4 18..79 CDD:304892 23/59 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 109..129 4/14 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1622159at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4325
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.