DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nf-YC and HAP5

DIOPT Version :9

Sequence 1:NP_572354.1 Gene:Nf-YC / 31622 FlyBaseID:FBgn0029905 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_015003.1 Gene:HAP5 / 854540 SGDID:S000005885 Length:242 Species:Saccharomyces cerevisiae


Alignment Length:108 Identity:55/108 - (50%)
Similarity:77/108 - (71%) Gaps:6/108 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 FWPNIVSEVHSIGQVDAKHQ------VLPLARIKKIMKLDENAKMIAGEAPLLFAKACEYFIQEL 191
            :|..:::|:.|..:..::||      .||.|||:|:||.||:.|||:.|||::||||||.||.||
Yeast   133 YWQELINEIESTNEPGSEHQDDFKSHSLPFARIRKVMKTDEDVKMISAEAPIIFAKACEIFITEL 197

  Fly   192 TMHAWVHTEESRRRTLQRSDIAQAIANYDQFDFLIDIVPREEI 234
            ||.||...|.::|||||::|||:|:...|.||||||:|||..:
Yeast   198 TMRAWCVAERNKRRTLQKADIAEALQKSDMFDFLIDVVPRRPL 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nf-YCNP_572354.1 HAP5 <130..>246 CDD:227533 55/108 (51%)
HAP5NP_015003.1 HAP5 1..>242 CDD:227533 55/108 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346829
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001272
OrthoInspector 1 1.000 - - oto99769
orthoMCL 1 0.900 - - OOG6_101766
Panther 1 1.100 - - LDO PTHR10252
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4325
SonicParanoid 1 1.000 - - X881
TreeFam 1 0.960 - -
109.730

Return to query results.
Submit another query.