DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nf-YC and DPB3

DIOPT Version :9

Sequence 1:NP_572354.1 Gene:Nf-YC / 31622 FlyBaseID:FBgn0029905 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_009837.1 Gene:DPB3 / 852580 SGDID:S000000482 Length:201 Species:Saccharomyces cerevisiae


Alignment Length:112 Identity:32/112 - (28%)
Similarity:52/112 - (46%) Gaps:15/112 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 NIVSEVHSIGQVDAKHQVLPLARIKKIMKLDENAKMIAGEAPLLFAKACEYFIQELTMHAWVHTE 200
            |:|.|         |..|.|::::|||.|.|....:.:..|....|.|.|.|:|.|...:.|..:
Yeast     3 NLVKE---------KAPVFPISKVKKIAKCDPEYVITSNVAISATAFAAELFVQNLVEESLVLAQ 58

  Fly   201 -ESRRRT---LQRSDIAQAIANYDQFDFLIDIVPREEIKPSSAQKTK 243
             .|:.:|   |..:.|.:.:...|.|.||.|.:  :::|.:||...|
Yeast    59 LNSKGKTSLRLSLNSIEECVEKRDNFRFLEDAI--KQLKKNSALDKK 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nf-YCNP_572354.1 HAP5 <130..>246 CDD:227533 32/112 (29%)
DPB3NP_009837.1 BUR6 <12..89 CDD:227572 22/76 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4325
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.