DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nf-YC and NF-YC3

DIOPT Version :9

Sequence 1:NP_572354.1 Gene:Nf-YC / 31622 FlyBaseID:FBgn0029905 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_175880.1 Gene:NF-YC3 / 841922 AraportID:AT1G54830 Length:217 Species:Arabidopsis thaliana


Alignment Length:216 Identity:78/216 - (36%)
Similarity:108/216 - (50%) Gaps:31/216 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 QQGQQQQQTVPMASLVSNACTLVNPSMSVTVATTVASGAKEKTTKATRTQVARKPPPTIDNFWPN 136
            ||||            |:|....:........||..:|:..........|..::....:.:||..
plant     3 QQGQ------------SSAMNYGSNPYQTNAMTTTPTGSDHPAYHQIHQQQQQQLTQQLQSFWET 55

  Fly   137 IVSEVHSIGQVDAKHQVLPLARIKKIMKLDENAKMIAGEAPLLFAKACEYFIQELTMHAWVHTEE 201
            ...|:..  ..|.|:..|||||||||||.||:.:||:.|||::||:|||.||.|||:.:|.||||
plant    56 QFKEIEK--TTDFKNHSLPLARIKKIMKADEDVRMISAEAPVVFARACEMFILELTLRSWNHTEE 118

  Fly   202 SRRRTLQRSDIAQAIANYDQFDFLIDIVPREEIKPSSAQKTKDGSTSSSSGMAGAASSAAS---- 262
            ::|||||::|||.|:...|.||||:||||||:::....           .|:...|::||.    
plant   119 NKRRTLQKNDIAAAVTRTDIFDFLVDIVPREDLRDEVL-----------GGVGAEAATAAGYPYG 172

  Fly   263 --TSNTATSNAAASVAGNATA 281
              ...||.......|.||..|
plant   173 YLPPGTAPIGNPGMVMGNPGA 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nf-YCNP_572354.1 HAP5 <130..>246 CDD:227533 58/115 (50%)
NF-YC3NP_175880.1 HAP5 <52..199 CDD:227533 68/155 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 98 1.000 Domainoid score I2401
eggNOG 1 0.900 - - E1_COG5208
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001272
OrthoInspector 1 1.000 - - otm2571
orthoMCL 1 0.900 - - OOG6_101766
Panther 1 1.100 - - O PTHR10252
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X881
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.770

Return to query results.
Submit another query.