DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nf-YC and NF-YC9

DIOPT Version :9

Sequence 1:NP_572354.1 Gene:Nf-YC / 31622 FlyBaseID:FBgn0029905 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_172371.1 Gene:NF-YC9 / 837417 AraportID:AT1G08970 Length:231 Species:Arabidopsis thaliana


Alignment Length:177 Identity:79/177 - (44%)
Similarity:105/177 - (59%) Gaps:25/177 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 QQQQQQQGQQQQQTVPMASLVSNACTLVNPSMSVTVATTVASGAKEKTTKA--------TRTQVA 123
            ||...|.|.....|.|..:         || || |.|.|||.||.:....|        .:.|:|
plant     3 QQDHGQSGAMNYGTNPYQT---------NP-MS-TTAATVAGGAAQPGQLAFHQIHQQQQQQQLA 56

  Fly   124 RKPPPTIDNFWPNIVSEVHSIGQVDAKHQVLPLARIKKIMKLDENAKMIAGEAPLLFAKACEYFI 188
            ::    :..||.|...|:..  ..|.|:..|||||||||||.||:.:||:.|||::||:|||.||
plant    57 QQ----LQAFWENQFKEIEK--TTDFKNHSLPLARIKKIMKADEDVRMISAEAPVVFARACEMFI 115

  Fly   189 QELTMHAWVHTEESRRRTLQRSDIAQAIANYDQFDFLIDIVPREEIK 235
            .|||:.:|.||||::|||||::|||.|:...|.||||:||||||:::
plant   116 LELTLRSWNHTEENKRRTLQKNDIAAAVTRTDIFDFLVDIVPREDLR 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nf-YCNP_572354.1 HAP5 <130..>246 CDD:227533 59/106 (56%)
NF-YC9NP_172371.1 HAP5 <62..213 CDD:227533 59/103 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 98 1.000 Domainoid score I2401
eggNOG 1 0.900 - - E1_COG5208
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001272
OrthoInspector 1 1.000 - - otm2571
orthoMCL 1 0.900 - - OOG6_101766
Panther 1 1.100 - - O PTHR10252
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X881
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.770

Return to query results.
Submit another query.