DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nf-YC and NF-YC7

DIOPT Version :9

Sequence 1:NP_572354.1 Gene:Nf-YC / 31622 FlyBaseID:FBgn0029905 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_199858.1 Gene:NF-YC7 / 835115 AraportID:AT5G50470 Length:212 Species:Arabidopsis thaliana


Alignment Length:112 Identity:48/112 - (42%)
Similarity:65/112 - (58%) Gaps:13/112 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 PTIDNFWPNIVSEVHSIGQ-VDAKHQVLPLARIKKIMKLDENAKMIAGEAPLLFAKACEYFIQEL 191
            |.:.|:|      :..:|. .|.||...||.|||||||.:....|:..|||:|.:||||..|.:|
plant    43 PQMRNYW------IAQMGNATDVKHHAFPLTRIKKIMKSNPEVNMVTAEAPVLISKACEMLILDL 101

  Fly   192 TMHAWVHTEESRRRTLQ------RSDIAQAIANYDQFDFLIDIVPRE 232
            ||.:|:||.|..|:||:      ||||:.|.....:|.||.|:|||:
plant   102 TMRSWLHTVEGGRQTLKRSDTLTRSDISAATTRSFKFTFLGDVVPRD 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nf-YCNP_572354.1 HAP5 <130..>246 CDD:227533 47/110 (43%)
NF-YC7NP_199858.1 HAP5 <41..>149 CDD:227533 48/112 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10252
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X881
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.870

Return to query results.
Submit another query.