DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nf-YC and NF-YC12

DIOPT Version :9

Sequence 1:NP_572354.1 Gene:Nf-YC / 31622 FlyBaseID:FBgn0029905 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_198630.2 Gene:NF-YC12 / 833794 AraportID:AT5G38140 Length:195 Species:Arabidopsis thaliana


Alignment Length:122 Identity:48/122 - (39%)
Similarity:69/122 - (56%) Gaps:19/122 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 PTIDNFWPN--IVSEVHSIGQVDAKHQV-----------------LPLARIKKIMKLDENAKMIA 173
            |.:|.|..|  ..|::..:..:|...:|                 |||:|::||:|.|...|.|:
plant    23 PMLDQFRSNHPETSKIEGVSSLDTALKVFWNNQREQLGNFAGQTHLPLSRVRKILKSDPEVKKIS 87

  Fly   174 GEAPLLFAKACEYFIQELTMHAWVHTEESRRRTLQRSDIAQAIANYDQFDFLIDIVP 230
            .:.|.||:|||||||.|:|:.||:||:...|.|::|.||.||:.|...:|||||.||
plant    88 CDVPALFSKACEYFILEVTLRAWMHTQSCTRETIRRCDIFQAVKNSGTYDFLIDRVP 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nf-YCNP_572354.1 HAP5 <130..>246 CDD:227533 47/120 (39%)
NF-YC12NP_198630.2 CBFD_NFYB_HMF 68..130 CDD:279185 32/61 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10252
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X881
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.870

Return to query results.
Submit another query.