DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nf-YC and NF-YC1

DIOPT Version :9

Sequence 1:NP_572354.1 Gene:Nf-YC / 31622 FlyBaseID:FBgn0029905 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_190428.1 Gene:NF-YC1 / 824019 AraportID:AT3G48590 Length:234 Species:Arabidopsis thaliana


Alignment Length:248 Identity:90/248 - (36%)
Similarity:123/248 - (49%) Gaps:38/248 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 QQTVPMASLVSNACTLVNPSMSVTVATTVASGAKEKTTKATRTQVARKPPPTIDNFWPNIVSEVH 142
            ||..|      :|..:..|....|:  :.|.|.      |:...:.::....:..||.....|:.
plant     6 QQPPP------SAAGIPPPPPGTTI--SAAGGG------ASYHHLLQQQQQQLQLFWTYQRQEIE 56

  Fly   143 SIGQVDAKHQVLPLARIKKIMKLDENAKMIAGEAPLLFAKACEYFIQELTMHAWVHTEESRRRTL 207
            .:.  |.|:..|||||||||||.||:.:||:.|||:|||||||.||.|||:.:|:|.||::||||
plant    57 QVN--DFKNHQLPLARIKKIMKADEDVRMISAEAPILFAKACELFILELTIRSWLHAEENKRRTL 119

  Fly   208 QRSDIAQAIANYDQFDFLIDIVPREEIKPSSA--------QKTKDG------STSSSSGMAGAAS 258
            |::|||.||...|.||||:|||||:|||..:|        ..|..|      .....:|..|...
plant   120 QKNDIAAAITRTDIFDFLVDIVPRDEIKDEAAVLGGGMVVAPTASGVPYYYPPMGQPAGPGGMMI 184

  Fly   259 SAASTSNTAT-----SNAAASVAGNATATGNFVASGSTVPATTAGGLKLDTTG 306
            ...:......     |.|..||...:|.||:.|:.||   ..::|...||..|
plant   185 GRPAMDPNGVYVQPPSQAWQSVWQTSTGTGDDVSYGS---GGSSGQGNLDGQG 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nf-YCNP_572354.1 HAP5 <130..>246 CDD:227533 65/129 (50%)
NF-YC1NP_190428.1 HAP5 <47..178 CDD:227533 65/132 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 98 1.000 Domainoid score I2401
eggNOG 1 0.900 - - E1_COG5208
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001272
OrthoInspector 1 1.000 - - otm2571
orthoMCL 1 0.900 - - OOG6_101766
Panther 1 1.100 - - O PTHR10252
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X881
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.770

Return to query results.
Submit another query.