DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nf-YC and Pole4

DIOPT Version :9

Sequence 1:NP_572354.1 Gene:Nf-YC / 31622 FlyBaseID:FBgn0029905 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001357224.1 Gene:Pole4 / 66979 MGIID:1914229 Length:172 Species:Mus musculus


Alignment Length:72 Identity:27/72 - (37%)
Similarity:44/72 - (61%) Gaps:0/72 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 LPLARIKKIMKLDENAKMIAGEAPLLFAKACEYFIQELTMHAWVHTEESRRRTLQRSDIAQAIAN 218
            |||||:|.::|.|.:..:...||..:.|:|.|.|::.:...|:...::.:|:||||.|:..||..
Mouse    42 LPLARVKALVKADPDVTLAGQEAIFILARAAELFVETIAKDAYCCAQQGKRKTLQRRDLDNAIEA 106

  Fly   219 YDQFDFL 225
            .|:|.||
Mouse   107 VDEFAFL 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nf-YCNP_572354.1 HAP5 <130..>246 CDD:227533 27/72 (38%)
Pole4NP_001357224.1 HAP5 <38..>113 CDD:227533 25/70 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4325
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.