powered by:
Protein Alignment Nf-YC and Pole4
DIOPT Version :9
Sequence 1: | NP_572354.1 |
Gene: | Nf-YC / 31622 |
FlyBaseID: | FBgn0029905 |
Length: | 601 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001357224.1 |
Gene: | Pole4 / 66979 |
MGIID: | 1914229 |
Length: | 172 |
Species: | Mus musculus |
Alignment Length: | 72 |
Identity: | 27/72 - (37%) |
Similarity: | 44/72 - (61%) |
Gaps: | 0/72 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 154 LPLARIKKIMKLDENAKMIAGEAPLLFAKACEYFIQELTMHAWVHTEESRRRTLQRSDIAQAIAN 218
|||||:|.::|.|.:..:...||..:.|:|.|.|::.:...|:...::.:|:||||.|:..||..
Mouse 42 LPLARVKALVKADPDVTLAGQEAIFILARAAELFVETIAKDAYCCAQQGKRKTLQRRDLDNAIEA 106
Fly 219 YDQFDFL 225
.|:|.||
Mouse 107 VDEFAFL 113
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Nf-YC | NP_572354.1 |
HAP5 |
<130..>246 |
CDD:227533 |
27/72 (38%) |
Pole4 | NP_001357224.1 |
HAP5 |
<38..>113 |
CDD:227533 |
25/70 (36%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5208 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R4325 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.840 |
|
Return to query results.
Submit another query.