powered by:
Protein Alignment Nf-YC and POLE4
DIOPT Version :9
Sequence 1: | NP_572354.1 |
Gene: | Nf-YC / 31622 |
FlyBaseID: | FBgn0029905 |
Length: | 601 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_063949.2 |
Gene: | POLE4 / 56655 |
HGNCID: | 18755 |
Length: | 117 |
Species: | Homo sapiens |
Alignment Length: | 72 |
Identity: | 27/72 - (37%) |
Similarity: | 44/72 - (61%) |
Gaps: | 0/72 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 154 LPLARIKKIMKLDENAKMIAGEAPLLFAKACEYFIQELTMHAWVHTEESRRRTLQRSDIAQAIAN 218
|||||:|.::|.|.:..:...||..:.|:|.|.|::.:...|:...::.:|:||||.|:..||..
Human 41 LPLARVKALVKADPDVTLAGQEAIFILARAAELFVETIAKDAYCCAQQGKRKTLQRRDLDNAIEA 105
Fly 219 YDQFDFL 225
.|:|.||
Human 106 VDEFAFL 112
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5208 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1622159at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R4325 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.850 |
|
Return to query results.
Submit another query.