DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nf-YC and pole4

DIOPT Version :9

Sequence 1:NP_572354.1 Gene:Nf-YC / 31622 FlyBaseID:FBgn0029905 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001016605.1 Gene:pole4 / 549359 XenbaseID:XB-GENE-5722002 Length:115 Species:Xenopus tropicalis


Alignment Length:76 Identity:29/76 - (38%)
Similarity:48/76 - (63%) Gaps:0/76 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 KHQVLPLARIKKIMKLDENAKMIAGEAPLLFAKACEYFIQELTMHAWVHTEESRRRTLQRSDIAQ 214
            |...|||:|||.:||.|.:..:.:.|:..:.:||.|.||:.:...|:::.::.:|:||||.|:..
 Frog    35 KQARLPLSRIKALMKADPDLSLASQESVFVISKATELFIETIAKDAYLYAQQGKRKTLQRKDLDN 99

  Fly   215 AIANYDQFDFL 225
            ||...|:|.||
 Frog   100 AIDAIDEFAFL 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nf-YCNP_572354.1 HAP5 <130..>246 CDD:227533 29/76 (38%)
pole4NP_001016605.1 CBFD_NFYB_HMF 38..101 CDD:279185 22/62 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1622159at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.