powered by:
Protein Alignment Nf-YC and pnhd
DIOPT Version :9
Sequence 1: | NP_572354.1 |
Gene: | Nf-YC / 31622 |
FlyBaseID: | FBgn0029905 |
Length: | 601 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_991150.1 |
Gene: | pnhd / 497366 |
ZFINID: | ZDB-GENE-081007-2 |
Length: | 316 |
Species: | Danio rerio |
Alignment Length: | 35 |
Identity: | 14/35 - (40%) |
Similarity: | 19/35 - (54%) |
Gaps: | 2/35 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 GTNKAPN--SNATSMFDNTITVTPIKMELGQAYAK 40
|:..||. |...:.||:|...||.|:||.|..|:
Zfish 181 GSKGAPEGFSCVPTKFDSTFIETPNKVELIQTVAQ 215
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Nf-YC | NP_572354.1 |
HAP5 |
<130..>246 |
CDD:227533 |
|
pnhd | NP_991150.1 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5208 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.