DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nf-YC and pnhd

DIOPT Version :9

Sequence 1:NP_572354.1 Gene:Nf-YC / 31622 FlyBaseID:FBgn0029905 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_991150.1 Gene:pnhd / 497366 ZFINID:ZDB-GENE-081007-2 Length:316 Species:Danio rerio


Alignment Length:35 Identity:14/35 - (40%)
Similarity:19/35 - (54%) Gaps:2/35 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GTNKAPN--SNATSMFDNTITVTPIKMELGQAYAK 40
            |:..||.  |...:.||:|...||.|:||.|..|:
Zfish   181 GSKGAPEGFSCVPTKFDSTFIETPNKVELIQTVAQ 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nf-YCNP_572354.1 HAP5 <130..>246 CDD:227533
pnhdNP_991150.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.