DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nf-YC and NC2alpha

DIOPT Version :9

Sequence 1:NP_572354.1 Gene:Nf-YC / 31622 FlyBaseID:FBgn0029905 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_611601.2 Gene:NC2alpha / 37471 FlyBaseID:FBgn0034650 Length:341 Species:Drosophila melanogaster


Alignment Length:182 Identity:50/182 - (27%)
Similarity:74/182 - (40%) Gaps:28/182 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 PLARIKKIMKLDENAKMIAGEAPLLFAKACEYFIQELTMHAWVHTEESRRRTLQRSDIAQAIANY 219
            |..||||||:.||....:|...|::.::..|.|::.|.......|.....:||..|.:.|.|.:.
  Fly    13 PAGRIKKIMQSDEEIGKVAQAVPVIISRTLELFVESLLTKTLRITNARNAKTLSPSHMRQCIVSE 77

  Fly   220 DQFDFLIDIV-----------------------PREEIKPSSAQKTKDGSTSSSSGMAGAASSAA 261
            .:||||.::|                       |.|:...|..  ..|.|..|:|..:.|..:||
  Fly    78 KRFDFLKELVRNIPDISVAEEAAYNEDDVLRSSPEEQYPDSDT--PYDLSLPSTSMRSQANGTAA 140

  Fly   262 STSNTATSNAAASVAGNATATGNFVASGST--VPAT-TAGGLKLDTTGATNA 310
            ...:.:.:|.|.|..|.|.....|.:..||  .|.| |....||..:|:..|
  Fly   141 YMRSMSLNNGAGSGGGAAATKRQFQSQHSTQETPTTSTTLPAKLARSGSMPA 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nf-YCNP_572354.1 HAP5 <130..>246 CDD:227533 29/113 (26%)
NC2alphaNP_611601.2 CBFD_NFYB_HMF 11..74 CDD:279185 19/60 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456664
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10252
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.