DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nf-YC and Chrac-16

DIOPT Version :9

Sequence 1:NP_572354.1 Gene:Nf-YC / 31622 FlyBaseID:FBgn0029905 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001285148.1 Gene:Chrac-16 / 32166 FlyBaseID:FBgn0043001 Length:140 Species:Drosophila melanogaster


Alignment Length:117 Identity:32/117 - (27%)
Similarity:52/117 - (44%) Gaps:25/117 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 RTQVARKPPPTIDNFWPNIVSEVHSIGQVDAKHQVLPLARIKKIMKLDENAKMIAGEAPLLFAKA 183
            |:|...:.|||.:.|                    |||:|::.|||...:..:|..|...|..|.
  Fly     5 RSQPPVERPPTAETF--------------------LPLSRVRTIMKSSMDTGLITNEVLFLMTKC 49

  Fly   184 CEYFIQELTMHAWVHTEESRRR---TLQRSDIAQAIANYDQFDFLIDIVPRE 232
            .|.|::.|...|  :|||..:|   .|:...::|.:......:||:.|||::
  Fly    50 TELFVRHLAGAA--YTEEFGQRPGEALKYEHLSQVVNKNKNLEFLLQIVPQK 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nf-YCNP_572354.1 HAP5 <130..>246 CDD:227533 27/106 (25%)
Chrac-16NP_001285148.1 CBFD_NFYB_HMF 19..83 CDD:366318 22/85 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456662
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5208
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1622159at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10252
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4325
SonicParanoid 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.