DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nf-YC and nfyc-1

DIOPT Version :9

Sequence 1:NP_572354.1 Gene:Nf-YC / 31622 FlyBaseID:FBgn0029905 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_493645.1 Gene:nfyc-1 / 173385 WormBaseID:WBGene00017742 Length:232 Species:Caenorhabditis elegans


Alignment Length:156 Identity:52/156 - (33%)
Similarity:89/156 - (57%) Gaps:23/156 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 DNFWPNIVSEVHSIGQVD----AKHQVLPLARIKKIMKLDENAK--MIAGEAPLLFAKACEYFIQ 189
            ::||.....::..|.:.|    :|:..:|:||:||||::|::.:  |||.:||:..|:|.|:||:
 Worm    83 EDFWREKKQKMTEISEEDMLNKSKNMSVPMARVKKIMRIDDDVRNFMIASDAPIFMAQAAEFFIE 147

  Fly   190 ELTMHAWVHTEESRRRTLQRSDIAQAIANYDQFDFLIDIVPREEIKPSSAQKTKDGSTSSSSGMA 254
            |:|...|.:..|:|||.||::|||.|:...||||||||.:|.:.:           .|:|::|..
 Worm   148 EMTAMGWQYVSEARRRILQKADIASAVQKSDQFDFLIDFLPPKTV-----------PTTSTNGPG 201

  Fly   255 GAASSAASTSN------TATSNAAAS 274
            ..:..:....|      ..|||::.:
 Worm   202 HMSEDSFQDPNMHSDFHQRTSNSSVN 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nf-YCNP_572354.1 HAP5 <130..>246 CDD:227533 45/120 (38%)
nfyc-1NP_493645.1 HAP5 65..>206 CDD:227533 48/133 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167940
Domainoid 1 1.000 71 1.000 Domainoid score I6207
eggNOG 1 0.900 - - E1_COG5208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001272
OrthoInspector 1 1.000 - - oto18062
orthoMCL 1 0.900 - - OOG6_101766
Panther 1 1.100 - - LDO PTHR10252
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4325
SonicParanoid 1 1.000 - - X881
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.730

Return to query results.
Submit another query.