DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pod1 and CORO2B

DIOPT Version :9

Sequence 1:NP_001245554.1 Gene:pod1 / 31620 FlyBaseID:FBgn0029903 Length:1266 Species:Drosophila melanogaster
Sequence 2:NP_006082.3 Gene:CORO2B / 10391 HGNCID:2256 Length:480 Species:Homo sapiens


Alignment Length:400 Identity:140/400 - (35%)
Similarity:220/400 - (55%) Gaps:19/400 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAWR--FKASKYKNAAPIVPKAEACVREICVGSYQTYGNNI-AASGAFMAFNWEHT-GSSVAVLP 61
            |:||  :::||::|....|...|.|...|.: :...:.|:. |.:..|:|...|.. |.|..|:|
Human     6 MSWRPQYRSSKFRNVYGKVANREHCFDGIPI-TKNVHDNHFCAVNTRFLAIVTESAGGGSFLVIP 69

  Fly    62 LDDCGRKSKTMPLLHGHTDTVTDLKFSPFHDGLLATASQDCLVKIWHIPEKGLEQSLSDPEAIFS 126
            |:..||.....|.:.||...|.|:|::||.|.::|:.|:|..|:||.|||.||::::::......
Human    70 LEQTGRIEPNYPKVCGHQGNVLDIKWNPFIDNIIASCSEDTSVRIWEIPEGGLKRNMTEALLELH 134

  Fly   127 HKQRRVETVGFHPTADGLMYSTAAGC---VALFDLSTQKEIFSNNEHPEVIQSASWREDGSVLAT 188
            ...|||..|.:|||.:.:::|  ||.   |.:::|...:.:...:.|.:||...|:..|||:|.|
Human   135 GHSRRVGLVEWHPTTNNILFS--AGYDYKVLIWNLDVGEPVKMIDCHTDVILCMSFNTDGSLLTT 197

  Fly   189 SCKDKNVRIFDPRAAGSPIQLTAESHQSIKDSRVVWLGNQHRILTTGFDAARLRQVIIRDVRNFN 253
            :||||.:|:.:||:.....:...::|   :.:|||:|||..|:||||......||:.:.|..:.:
Human   198 TCKDKKLRVIEPRSGRVLQEANCKNH---RVNRVVFLGNMKRLLTTGVSRWNTRQIALWDQEDLS 259

  Fly   254 TPEKTLELDCSTGILMPLFDPDTNMLFLAGKGDTTINYLEITDKDPYL--IEGLRHTGEQTKGAC 316
            .|....|:|..:|:|.|.:|.||:||:||||||..|.|.||:.:.|||  :...|....| ||..
Human   260 MPLIEEEIDGLSGLLFPFYDADTHMLYLAGKGDGNIRYYEISTEKPYLSYLMEFRSPAPQ-KGLG 323

  Fly   317 LVPKRALKVMEAEVNRVLQLTS--NMVIPIMYQVPRKTYRDFHADLYPETTGYKTELVAGEWLNG 379
            ::||..|.|...||.|..:|.:  .::.||...|||:: ..:..|:||.|.|.:..|...|||.|
Human   324 VMPKHGLDVSACEVFRFYKLVTLKGLIEPISMIVPRRS-DSYQEDIYPMTPGTEPALTPDEWLGG 387

  Fly   380 SNQAVPKMSL 389
            .|:....|||
Human   388 INRDPVLMSL 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pod1NP_001245554.1 DUF1899 6..62 CDD:286094 15/57 (26%)
WD40 <75..237 CDD:295369 59/164 (36%)
WD40 repeat 83..127 CDD:293791 16/43 (37%)
WD40 repeat 132..166 CDD:293791 10/36 (28%)
WD40 repeat 174..210 CDD:293791 14/35 (40%)
WD40 repeat 217..260 CDD:293791 15/42 (36%)
WD40 repeat 267..294 CDD:293791 15/26 (58%)
WD40_4 341..384 CDD:292916 16/42 (38%)
DUF1899 808..866 CDD:286094
WD40 843..1116 CDD:295369
WD40 repeat 884..923 CDD:293791
WD40 repeat 937..973 CDD:293791
WD40 repeat 979..1016 CDD:293791
WD40 repeat 1024..1064 CDD:293791
WD40 repeat 1071..1094 CDD:293791
WD40_4 1146..1189 CDD:292916
CORO2BNP_006082.3 WD40 repeat 45..85 CDD:293791 12/39 (31%)
WD 2 78..127 20/48 (42%)
WD40 repeat 91..135 CDD:293791 16/43 (37%)
WD 3 128..170 12/43 (28%)
WD40 repeat 140..177 CDD:293791 10/38 (26%)
WD 4 171..212 16/40 (40%)
WD40 repeat 184..219 CDD:293791 13/34 (38%)
WD 5 213..259 15/48 (31%)
WD40 repeat 225..266 CDD:293791 15/40 (38%)
WD 6 260..305 21/44 (48%)
WD40 repeat 273..312 CDD:293791 20/38 (53%)
WD 7 306..345 14/39 (36%)
WD40 15..460 CDD:421866 136/390 (35%)
WD 1 29..77 14/48 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D179930at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.