DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pod1 and LOC100496364

DIOPT Version :9

Sequence 1:NP_001245554.1 Gene:pod1 / 31620 FlyBaseID:FBgn0029903 Length:1266 Species:Drosophila melanogaster
Sequence 2:XP_004919261.2 Gene:LOC100496364 / 100496364 -ID:- Length:209 Species:Xenopus tropicalis


Alignment Length:132 Identity:54/132 - (40%)
Similarity:81/132 - (61%) Gaps:2/132 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly  1065 LDVSPSILIPFYDEDSSTLFVTGKGDSTIYCYEITDEEPYICPLSHHRCTSLHQGLSFLTKNHCD 1129
            :|.|..:|:||||.||:.:::.|||||:|..:|||.|.|::..||.:......:|:.|:.|...|
 Frog     1 MDTSNGVLLPFYDSDSNVVYLCGKGDSSIRYFEITAEAPFVHYLSTYSSKEPQRGMGFMPKRGLD 65

  Fly  1130 VASVEFSKAYRLTNTTIEPLSFTVPRIKSELFQDDLFPPTRITWSATLSSEDWFASNDKAAPKVS 1194
            |:..|.::.::|.....||:..|||| ||:||||||:|.|.....| |.:|:||:..|.....||
 Frog    66 VSKCEIARFFKLHERKCEPIVMTVPR-KSDLFQDDLYPDTPGPEPA-LEAEEWFSGQDADPILVS 128

  Fly  1195 LK 1196
            |:
 Frog   129 LR 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pod1NP_001245554.1 DUF1899 6..62 CDD:286094
WD40 <75..237 CDD:295369
WD40 repeat 83..127 CDD:293791
WD40 repeat 132..166 CDD:293791
WD40 repeat 174..210 CDD:293791
WD40 repeat 217..260 CDD:293791
WD40 repeat 267..294 CDD:293791
WD40_4 341..384 CDD:292916
DUF1899 808..866 CDD:286094
WD40 843..1116 CDD:295369 22/50 (44%)
WD40 repeat 884..923 CDD:293791
WD40 repeat 937..973 CDD:293791
WD40 repeat 979..1016 CDD:293791
WD40 repeat 1024..1064 CDD:293791
WD40 repeat 1071..1094 CDD:293791 12/22 (55%)
WD40_4 1146..1189 CDD:292916 22/42 (52%)
LOC100496364XP_004919261.2 WD40 <1..166 CDD:421866 54/132 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D179930at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.