DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C3G and YCL068C

DIOPT Version :9

Sequence 1:NP_572350.2 Gene:C3G / 31618 FlyBaseID:FBgn0259228 Length:1571 Species:Drosophila melanogaster
Sequence 2:NP_009865.2 Gene:YCL068C / 850291 SGDID:S000000573 Length:260 Species:Saccharomyces cerevisiae


Alignment Length:142 Identity:32/142 - (22%)
Similarity:58/142 - (40%) Gaps:40/142 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly  1158 ITRYLILKKREED---------------GPEVKGGYIDALIVHASRVQKVADNAFCEAFITTFRT 1207
            ::|...|.||.:|               |.:..   :||:::       |.::|:  .|:..:|.
Yeast    85 VSRECPLVKRSQDIKRARKRLLSDWYRLGADAN---MDAVLL-------VVNSAW--RFLAVWRP 137

  Fly  1208 FIQPID-VIEKLTHRYTYFFCQVQDNKQKAAKETFALLVRVVNDLTSTDLTSQLLSLLVEFVYQL 1271
            |:..|. ..::|.....::......|.|:..    |||..|:.   ..||...:..:|.| |:::
Yeast   138 FVNSIQHATQELYQNIAHYLLHGNVNIQRVT----ALLQLVMG---QDDLLFSMDDVLQE-VFRI 194

  Fly  1272 VCSGQLYLAKLL 1283
                ||||.|:|
Yeast   195 ----QLYLNKML 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C3GNP_572350.2 RasGEFN 1170..1306 CDD:214571 28/130 (22%)
RasGEF 1335..1558 CDD:238087
YCL068CNP_009865.2 REM 196..>257 CDD:413353 5/7 (71%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.