DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C3G and LOC797658

DIOPT Version :9

Sequence 1:NP_572350.2 Gene:C3G / 31618 FlyBaseID:FBgn0259228 Length:1571 Species:Drosophila melanogaster
Sequence 2:XP_009301929.2 Gene:LOC797658 / 797658 -ID:- Length:598 Species:Danio rerio


Alignment Length:284 Identity:73/284 - (25%)
Similarity:127/284 - (44%) Gaps:41/284 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly  1328 GGGNQPS-LLDLKSL--------------------------------EIAEQMTLLDAELFTKIE 1359
            ||...|| |:|::|:                                |:||.:|.|:.:.|.||.
Zfish   105 GGNETPSQLIDVESVPSYKWKRQVTKRVPSMSKRRKMSLLFDHLDPYELAEHLTYLEYKSFCKIL 169

  Fly  1360 IPEVLLFAKDQCEEKSPNLNKFTEHFNKMSYWARSKILRLQDAKEREKHVNKFIKIMKHLRKMNN 1424
            ..:...|....|...:|.|.:|...||.:|.|.:..:|....|.:|...:..||::.:.|.::.|
Zfish   170 FQDYHSFVMHGCTVDNPILERFITLFNSVSQWIQLMVLSKPTAPQRAAVIAHFIQVAEKLLQLQN 234

  Fly  1425 YNSYLALLSALDSGPIRRL-EWQKGITEEV-RSFCALID---SSSSFRAYRQALAETNPPCIPYI 1484
            :|:.:|::..|.:..|.|| |.|..|:.:. :.|.:|:|   ||.::..||:..||......|.:
Zfish   235 FNTLMAVVGGLSNSSISRLKETQANISSDTNKVFNSLLDMLTSSGNYSQYRRRFAECTGFRFPIL 299

  Fly  1485 GLILQDLTFVHVGNQDY--LSKGVINFSKRWQQYNIIDNMKRFKKCAYPFRRNERIIRFFD-NFK 1546
            .:.|:||..|||...|:  ..|..:|.:|..|.|.|:..:...:........|..::.... :..
Zfish   300 AVSLKDLIAVHVALSDWTDAQKTQVNLTKTQQLYAILQELSLVQSNPPHIEANTDLLNLLTVSLD 364

  Fly  1547 DFMGEEEMWQISEKIKPRGRRPVN 1570
            .:..|||::|:|.:.:||..:|.|
Zfish   365 QYHTEEEIYQLSLQREPRATKPAN 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C3GNP_572350.2 RasGEFN 1170..1306 CDD:214571
RasGEF 1335..1558 CDD:238087 64/262 (24%)
LOC797658XP_009301929.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.