DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C3G and RALGPS2

DIOPT Version :9

Sequence 1:NP_572350.2 Gene:C3G / 31618 FlyBaseID:FBgn0259228 Length:1571 Species:Drosophila melanogaster
Sequence 2:NP_689876.2 Gene:RALGPS2 / 55103 HGNCID:30279 Length:583 Species:Homo sapiens


Alignment Length:294 Identity:82/294 - (27%)
Similarity:140/294 - (47%) Gaps:40/294 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly  1307 GGAGSVGGAGIAG--SGGCSGTAGGGNQP---------SLLDLKSLEIAEQMTLLDAELFTKIEI 1360
            |.|.||..|..|.  |......:..|::.         .:|.:...|.|.|:||:|..:|..|:.
Human     6 GQASSVNIAATASEKSSSSESLSDKGSELKKSFDAVVFDVLKVTPEEYAGQITLMDVPVFKAIQP 70

  Fly  1361 PEVLLFAKDQCEEKS--PNLNKFTEHFNKMSYWARSKILRLQDAKEREKHVNKFIKIMKHLRKMN 1423
            .|:.....::.|:.|  ||...||..||.:|:|...:||..|..|.|.:.::.:||..|.|.::|
Human    71 DELSSCGWNKKEKYSSAPNAVAFTRRFNHVSFWVVREILHAQTLKIRAEVLSHYIKTAKKLYELN 135

  Fly  1424 NYNSYLALLSALDSGPIRRL--EW------QKGITEEVRSFCALIDSSSSFRAYRQALAETNPPC 1480
            |.::.:|::|.|.|.||.||  .|      .|...|::....:..|:....|.|..:|..|  ||
Human   136 NLHALMAVVSGLQSAPIFRLTKTWALLSRKDKTTFEKLEYVMSKEDNYKRLRDYISSLKMT--PC 198

  Fly  1481 IPYIGLILQDLTFVHVGNQDYLSKGVINFSKRWQQYNIIDNMKRF-----KKCAYPF------RR 1534
            |||:|:.|.|||::   :..|.|.|.|  .:..|:.|:::|:.|.     :.|.|..      ::
Human   199 IPYLGIYLSDLTYI---DSAYPSTGSI--LENEQRSNLMNNILRIISDLQQSCEYDIPMLPHVQK 258

  Fly  1535 NERIIRFFDNFKDFMGEEEMWQISEKIKPRGRRP 1568
            ....:::.:..:.|: |::.:::|.||:|....|
Human   259 YLNSVQYIEELQKFV-EDDNYKLSLKIEPGTSTP 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C3GNP_572350.2 RasGEFN 1170..1306 CDD:214571
RasGEF 1335..1558 CDD:238087 69/243 (28%)
RALGPS2NP_689876.2 RasGEF 45..286 CDD:214539 72/248 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 283..314 4/9 (44%)
PXXP 324..327
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 372..406
Required for stimulation of nucleotide exchange by RALA. /evidence=ECO:0000250 459..583
PH_RalGPS1_2 459..574 CDD:270120
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.