DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C3G and CG5522

DIOPT Version :9

Sequence 1:NP_572350.2 Gene:C3G / 31618 FlyBaseID:FBgn0259228 Length:1571 Species:Drosophila melanogaster
Sequence 2:NP_725613.1 Gene:CG5522 / 36881 FlyBaseID:FBgn0034158 Length:702 Species:Drosophila melanogaster


Alignment Length:287 Identity:76/287 - (26%)
Similarity:133/287 - (46%) Gaps:54/287 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly  1320 SGGCSGTAGGG--------NQPSLLDLKSLE-------------IAEQMTLLDAELFTKIEIPEV 1363
            |.||..|....        :.|:...:|.|:             :|.|:||||..:|.:|:..|:
  Fly   126 SPGCYYTIAASAAPPSKSQSLPAHASIKQLDAVILSALRVPADVLANQITLLDFPVFAQIQPDEL 190

  Fly  1364 --LLFAKDQCEEKSPNLNKFTEHFNKMSYWARSKILRLQDAKEREKHVNKFIKIMKHLRKMNNYN 1426
              ..:.|......:||:..||:.||..|:|...:||..:..|:|.:.:..|||:.|.|.::||.:
  Fly   191 SSCAWTKKDKHVNTPNIVAFTKRFNHTSFWTVQEILNAEQPKQRAEIITHFIKVAKKLHELNNLH 255

  Fly  1427 SYLALLSALDSGPIRRL--EWQKGITEEVRSFCALIDSSS------SFRAYRQALAETNPPCIPY 1483
            |..|::||:.|..|.||  .|.....::..:|..|.|..|      :.|:|.::|   ..|||||
  Fly   256 SLFAIISAMQSASIYRLTKTWACLSKKDRNAFDRLSDIFSDQDNWANLRSYLESL---RLPCIPY 317

  Fly  1484 IGLILQDLTFV-----HVGNQDYLSKGVINFSKRWQQYNIIDNMKRFKKCAYP-FRRNERI---- 1538
            :||.|.||.::     |.|       |:....:|.:..||:..:..:::..|. .:::|..    
  Fly   318 LGLFLTDLIYIDLAHPHKG-------GLEPEQRRNKMNNILRVISNYQQSNYKHLQKHEATQKYL 375

  Fly  1539 --IRFFDNFKDFMGEEEMWQISEKIKP 1563
              ||:.:..::.. ||:.::.|..::|
  Fly   376 TSIRYIEELQNIF-EEDQYKRSLNLEP 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C3GNP_572350.2 RasGEFN 1170..1306 CDD:214571
RasGEF 1335..1558 CDD:238087 69/257 (27%)
CG5522NP_725613.1 RasGEF 163..400 CDD:214539 68/247 (28%)
PH_RalGPS1_2 578..692 CDD:270120
PH 578..685 CDD:278594
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467920
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3417
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23113
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.