DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment C3G and Rasgrp2

DIOPT Version :9

Sequence 1:NP_572350.2 Gene:C3G / 31618 FlyBaseID:FBgn0259228 Length:1571 Species:Drosophila melanogaster
Sequence 2:NP_001076446.2 Gene:Rasgrp2 / 361714 RGDID:1311630 Length:608 Species:Rattus norvegicus


Alignment Length:410 Identity:91/410 - (22%)
Similarity:162/410 - (39%) Gaps:83/410 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly  1191 KVADNAFCEAFITTFRTFIQPIDVIEKLTHRYTYFFCQVQDNKQKAAKETFALLVRVVNDLTST- 1254
            ||.|......|:.....:|....:..||.|.|..   ..:||......:|..|:...|:...:. 
  Rat    29 KVRDPQLVRMFLMMHPWYIPSSQLASKLLHFYQQ---SRKDNSNSLQVKTCHLVRYWVSAFPAEF 90

  Fly  1255 DLTSQLLSLLVEFVYQLVCSGQLYLAKLLRNKFVEKVTLYK-----------EPKVYGFVGELGG 1308
            ||..:|...:.|....|...|....:.|:.   :|.|..||           |.|          
  Rat    91 DLNPELAEQIKELKALLDQEGNRRHSSLID---IESVPTYKWKRQVTQRNPVEQK---------- 142

  Fly  1309 AGSVGGAGIAGSGGCSGTAGGGNQPSLL--DLKSLEIAEQMTLLDAELFTKIEIPEVLLFAKDQC 1371
                                 ..:.|||  .|:.:|:||.:|.|:...|.||...:...|....|
  Rat   143 ---------------------KRKMSLLFDHLEPMELAEHLTYLEYRSFCKILFQDYHSFVTHGC 186

  Fly  1372 EEKSPNLNKFTEHFNKMSYWARSKILRLQDAKEREKHVNKFIKIMKHLRKMNNYNSYLALLSALD 1436
            ...:|.|.:|...||.:|.|.:..||....|.:|...:..|:.:.:.|.::.|:|:.:|::..|.
  Rat   187 TVDNPVLERFISLFNSVSQWVQLMILSKPTATQRALVITHFVHVAEKLLQLQNFNTLMAVVGGLS 251

  Fly  1437 SGPIRRLE-------------WQKGITEEVRSFCALIDSSSSFRAYRQALAETNPPCI----PYI 1484
            ...|.||:             |: |:||       |:.::.::..||:.||    .|:    |.:
  Rat   252 HSSISRLKETHSHVSPDTIKLWE-GLTE-------LVTATGNYSNYRRRLA----ACVGFRFPIL 304

  Fly  1485 GLILQDLTFVHVGNQDYLSKG--VINFSKRWQQYNIIDNMKRFKKCAYPFRRNERIIRFFD-NFK 1546
            |:.|:||..:.:...|:|..|  .:|.:|..|.::|::.:........|.:.|..::.... :..
  Rat   305 GVHLKDLVALQLALPDWLDPGRTRLNGAKMRQLFSILEELAMVTSLRPPVQANPDLLSLLTVSLD 369

  Fly  1547 DFMGEEEMWQISEKIKPRGR 1566
            .:..|:|::|:|.:.:||.:
  Rat   370 QYQTEDELYQLSLQREPRSK 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
C3GNP_572350.2 RasGEFN 1170..1306 CDD:214571 27/126 (21%)
RasGEF 1335..1558 CDD:238087 60/244 (25%)
Rasgrp2NP_001076446.2 RasGEFN 7..121 CDD:214571 21/97 (22%)
RasGEF 150..387 CDD:214539 59/248 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 382..405 2/8 (25%)
EFh 430..481 CDD:238008
C1_RASGRP2 496..551 CDD:410411
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 555..596
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3417
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.